SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 380703.AHA_3570 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  380703.AHA_3570
Domain Number 1 Region: 91-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000693
Family NfeD domain-like 0.0085
Further Details:      
 
Weak hits

Sequence:  380703.AHA_3570
Domain Number - Region: 19-78
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.051
Family LacY-like proton/sugar symporter 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 380703.AHA_3570
Sequence length 151
Comment (Aeromonas hydrophila ATCC 7966)
Sequence
MTALFEGLTHWHWLGLGFALLAIEVLGSVGFLLWTGIAALEVGLLLLVWPFGWQAQLLLF
GLQSLLTTWAWWRWQHRRDRSSRDAAAPINERMQGYLGRELVLLDDVTQGMSRVHLDDTA
WTVRCNQPLSAGSKVRVTGHDSHILLVEPLP
Download sequence
Identical sequences A0A1B8YV88 A0KP39
gi|117619384|ref|YP_858040.1| WP_011707312.1.100377 WP_011707312.1.12787 WP_011707312.1.28436 WP_011707312.1.34034 WP_011707312.1.41987 WP_011707312.1.52677 WP_011707312.1.56470 WP_011707312.1.62309 WP_011707312.1.67280 WP_011707312.1.95182 YP_858040.1.44769 380703.AHA_3570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]