SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 380749.HY04AAS1_1092 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  380749.HY04AAS1_1092
Domain Number - Region: 123-154
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000562
Family NfeD domain-like 0.013
Further Details:      
 
Domain Number - Region: 4-71
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0144
Family Rhomboid-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 380749.HY04AAS1_1092
Sequence length 157
Comment (Hydrogenobaculum Y04AAS1)
Sequence
MSPFLWILLGILLSLLELAHPVMIFFPIGLSAIATGIFGLLIEYFTKIPYERMLITQLIT
FFVVSAINIYLLRKISKEWISIKTPKSSQPENAILGHEVYAKEDAKAKTMIKVESPSPIL
GVNLWHAKVLDDVKAGDKLIVVGHEGGILVCKKASSD
Download sequence
Identical sequences B4U9G7
WP_012514134.1.45798 gi|195953466|ref|YP_002121756.1| 380749.HY04AAS1_1092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]