SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 381666.H16_A2767 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  381666.H16_A2767
Domain Number 1 Region: 44-228
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.97e-27
Family Clp protease, ClpP subunit 0.033
Further Details:      
 
Domain Number 2 Region: 402-464
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000536
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 381666.H16_A2767
Sequence length 486
Comment (Ralstonia eutropha H16)
Sequence
MSGRLLAGLALACGAVALAGPGARAAPPSGASAPAATVTTTATAPVYVIPLKGAVSPASA
SFILRSMERARAGGAQLVVLEMDTPGGLDASMREIIQAILASPIPVASYVYPGGARAASA
GTYILYASHIAAMAPGTNLGAATPVQVGIGGPQKPEALPGAKPASTPASEPARADAMERK
QMHDASAYIRGLAQLRGRNAEWAERAVRESVSLSADEALAQRVVDLVAPDLPALLRQVEG
RTITAAGGKAGVLHTANAPVVTLEPDWRNRFLAVITEPSVALLLLMIGIYGLIFEFSTPG
MVVPGIAGAICLLVALFALHMLPVNYAGLALVALGIGCMVAELFLPSFGALGVGGIIAFA
FGAVMLIDTDVPGFGVPLPMVAAMSALSAIFVFGMSAMLVRSRKRPVVSGADTLVGARGE
MLDDLREEGWATVRGETWRVHSASSLPRGTPVVVTARKGLVLEVIAAGNAPLVPTTPPQP
TPDKGA
Download sequence
Identical sequences Q0K825
WP_011615820.1.70127 gi|113868725|ref|YP_727214.1| 381666.H16_A2767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]