SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 381754.PSPA7_0553 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  381754.PSPA7_0553
Domain Number 1 Region: 26-194
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.28e-25
Family Clp protease, ClpP subunit 0.041
Further Details:      
 
Domain Number 2 Region: 370-436
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000929
Family NfeD domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 381754.PSPA7_0553
Sequence length 443
Comment (Pseudomonas aeruginosa PA7)
Sequence
MRMPWRLALALWLCLAGQACLAASATVRVLSVDGAIGPASADYLVRGIQRAAEDGAQLVV
LEMDTPGGLDPSMRRIVKAILASRVPVAGFVAPAGARAASAGTYILYACHVAAMAPGTNL
GAATPVALGAPDEAEGKPPARGAGPMARKQVNDAAAYIRGLAQLRGRNAEWAERAVREAV
SLAASEAAAQKVIDLQARDLPDLLRQLDGRSLRVGERALTLATTGATVERQAPDWRARLL
AVLTDPSVALILMMIGIYGLIFELANPGMALPGVLGGICLLLGLYALQMLPVNYAGLALI
ALGLAFMVGEAFVASFGVLGIGGIVSFVAGALILIDTEVPGYGIPPGLVVALALLSAALI
VGLLGMALRARRQAVVSGTAGLVGSLATVAAVDPEQPCAGWVLLQGERWRVLATRPLAVG
QPVWVLARKGLLLEVALADEGGG
Download sequence
Identical sequences A6UYR3
gi|152983495|ref|YP_001345948.1| WP_012074033.1.55765 WP_012074033.1.56850 WP_012074033.1.6249 WP_012074033.1.84917 WP_012074033.1.86660 WP_012074033.1.90922 WP_012074033.1.92974 381754.PSPA7_0553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]