SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 381754.PSPA7_2448 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  381754.PSPA7_2448
Domain Number 1 Region: 37-174
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.000000000000811
Family Regulatory protein AraC 0.009
Further Details:      
 
Domain Number 2 Region: 250-296
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000627
Family AraC type transcriptional activator 0.027
Further Details:      
 
Weak hits

Sequence:  381754.PSPA7_2448
Domain Number - Region: 194-243
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00627
Family Homeodomain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 381754.PSPA7_2448
Sequence length 299
Comment (Pseudomonas aeruginosa PA7)
Sequence
MQPSLSRTVEQVRYAPPGEYALDLEVVAFDELRRRTTPAHLHALQRTDFHLLLAVTRGCC
THWIDFRPHRAEAGNWLVIQPGQVHRFDGSADWSGWLLLFRPEFLAPPGRGGTAEELAVG
VCLEALPALLAPAADERRSCLQALRQMARDARLRQSRAVRHSLLRHQLQALLLRLDLVAR
DSRLAPLASGAELQRFNRFREAVTGNFQRHHRIGEYARLLGISERSLSRASQAVAGVTAK
AWLSARIALEARRLLAHTDETVAAIAERLGFDEPSNFVKFFKRETGQVPGAFRREQRGG
Download sequence
Identical sequences A6V430
381754.PSPA7_2448 gi|152984212|ref|YP_001347815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]