SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 381754.PSPA7_4313 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  381754.PSPA7_4313
Domain Number - Region: 47-115
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0335
Family FCH domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 381754.PSPA7_4313
Sequence length 132
Comment (Pseudomonas aeruginosa PA7)
Sequence
MIQCKRVYEPASPADGRRVLVDRLWPRGIRKEALAMDDWLKEVAPSSEVRKRFSHDPALF
DSFRERYRAELQAHPEHWWGLLDSAREGTLTLLYGAHDQRHNNAVVLAEFLEEELDRQQP
GSSPTCYADRLS
Download sequence
Identical sequences A0A0Q0RSV1 A6V9D1
WP_012076734.1.30810 WP_012076734.1.34731 WP_012076734.1.56850 WP_012076734.1.6249 WP_012076734.1.63989 WP_012076734.1.66584 WP_012076734.1.84917 WP_012076734.1.90922 gi|152988119|ref|YP_001349666.1| 381754.PSPA7_4313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]