SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 381754.PSPA7_5956 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  381754.PSPA7_5956
Domain Number - Region: 108-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00471
Family NfeD domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 381754.PSPA7_5956
Sequence length 156
Comment (Pseudomonas aeruginosa PA7)
Sequence
MEPLLQLDFWDWLALGTVLLLLEIFGAGGYLLRTGLTAACVGALSAFLPGLAWPWQVLLF
AGLSALTAGEQWRRRRMAGGCRATPGLHRRGDDLLGRSFPLHRAIVGGLGELRVEGALWL
VSGPDLPRGALVRVTGQDGALLRVEPAAPGNATAPG
Download sequence
Identical sequences A0A0V2R9Y1 A6VDY7
gi|152988708|ref|YP_001351272.1| WP_012077837.1.56850 WP_012077837.1.6249 WP_012077837.1.84917 WP_012077837.1.90922 381754.PSPA7_5956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]