SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 381764.Fnod_0044 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  381764.Fnod_0044
Domain Number 1 Region: 5-183
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.53e-35
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 381764.Fnod_0044
Sequence length 198
Comment (Fervidobacterium nodosum Rt17-B1)
Sequence
MIRPFSIRIAGIGGQGNLLAGYILSEAFVLMEKYVIQTQNYSEQVRGGPSYCDVLVSDEQ
ILYPKAVLFDSLIIMHPSMVSHGKYVATNGIIIYDSTNIQNLPNEIKRITRRIIEIPASK
LAIEKYGNAMVSNMILLGAFVKSTGLVDFETLFEAVREEVNPKYFDMNVEAIKLGASLTD
KIFKPRLERKRKRTIGFE
Download sequence
Identical sequences A7HJ32
381764.Fnod_0044 WP_011993238.1.63945 gi|154248747|ref|YP_001409572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]