SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 381764.Fnod_0728 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  381764.Fnod_0728
Domain Number 1 Region: 79-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000418
Family NfeD domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 381764.Fnod_0728
Sequence length 152
Comment (Fervidobacterium nodosum Rt17-B1)
Sequence
MITPVAFWIIFGVILMVIEIFTPTFFIFWFGLGSLAAAVVAYFYENTLFELLTFIIVSGI
LVLSSRKLAKKITGEEVRSINVDEIVGKEAVVIEKIDNRQSKGVVKVNGDMWRAVSFDDN
VTFEQGDYVIIDRVEGAHVVVKPKEIEKTDEH
Download sequence
Identical sequences A7HL00
WP_011993901.1.63945 gi|154249415|ref|YP_001410240.1| 381764.Fnod_0728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]