SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 382245.ASA_3526 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  382245.ASA_3526
Domain Number 1 Region: 91-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000209
Family NfeD domain-like 0.0064
Further Details:      
 
Weak hits

Sequence:  382245.ASA_3526
Domain Number - Region: 26-78
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0314
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 382245.ASA_3526
Sequence length 151
Comment (Aeromonas salmonicida A449)
Sequence
MTALLEGLTHWHWLGLGFILLAIEVLGSVGFLLWTGIAALEVGLLLLLWPFGWQAQLLLF
AVQSLLTTWAWWRWQHKRDRSGRDAAAPINERMQGYVGRELVLLDDVVQGLSRVHLDDTV
WTVRSQMPLTAGSRVKVVGTDSHILLVEPLP
Download sequence
Identical sequences A0A1Q4MDW7 A0A1Z1NXA6 A0A248KTU0 A0A290VF56 A4SRH2
gi|145300401|ref|YP_001143242.1| WP_005318764.1.10171 WP_005318764.1.13540 WP_005318764.1.1406 WP_005318764.1.18386 WP_005318764.1.22899 WP_005318764.1.2366 WP_005318764.1.23756 WP_005318764.1.28352 WP_005318764.1.29842 WP_005318764.1.33624 WP_005318764.1.36887 WP_005318764.1.38021 WP_005318764.1.40195 WP_005318764.1.41377 WP_005318764.1.46813 WP_005318764.1.49611 WP_005318764.1.49680 WP_005318764.1.51049 WP_005318764.1.51485 WP_005318764.1.52154 WP_005318764.1.53881 WP_005318764.1.57660 WP_005318764.1.5833 WP_005318764.1.62078 WP_005318764.1.75420 WP_005318764.1.79205 WP_005318764.1.86551 WP_005318764.1.86591 WP_005318764.1.8755 WP_005318764.1.91946 WP_005318764.1.93610 382245.ASA_3526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]