SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 382245.ASA_3734 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  382245.ASA_3734
Domain Number 1 Region: 92-291
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.05e-42
Family D-glucarate dehydratase-like 0.00013
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.24e-17
Family Enolase N-terminal domain-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 382245.ASA_3734
Sequence length 305
Comment (Aeromonas salmonicida A449)
Sequence
MKLALYRYQLPFTQPLTFHGKVEVAREGLLVRVDKGWGEIAPLPGFSKETLAEALACLEQ
LAQGQPISPLLPSVQFGFDCARRIWPEQAATLPAPYPLIQGSPQELLKHWKDWLHQTPSK
AKLKVARYPMRDELALIRLLCDRIPTLKLVLDANQGWTREEAWAFCGHLDPNRIEYLEDP
CANFDDIAFVANRTGMPVAIDELLAQGKPWEPIPQLRALVLKPMLLGSLANSEALVARAR
ELRLKVIVSSCFESGVGLGQLARLAGEWAPDQAPGLDTKRWLASDLLDTQGTPDLSLLEP
LFHRD
Download sequence
Identical sequences A0A1Q4MEK0 A0A248L1B1 A0A290VDZ1 A4SS23
gi|145300602|ref|YP_001143443.1| WP_005316010.1.10171 WP_005316010.1.13540 WP_005316010.1.1406 WP_005316010.1.22899 WP_005316010.1.2366 WP_005316010.1.23756 WP_005316010.1.28352 WP_005316010.1.29842 WP_005316010.1.36887 WP_005316010.1.38021 WP_005316010.1.40195 WP_005316010.1.41377 WP_005316010.1.44620 WP_005316010.1.46813 WP_005316010.1.49611 WP_005316010.1.49680 WP_005316010.1.51049 WP_005316010.1.51485 WP_005316010.1.52154 WP_005316010.1.53881 WP_005316010.1.57660 WP_005316010.1.5833 WP_005316010.1.62078 WP_005316010.1.75420 WP_005316010.1.79205 WP_005316010.1.86551 WP_005316010.1.86591 WP_005316010.1.8755 WP_005316010.1.91946 WP_005316010.1.93610 382245.ASA_3734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]