SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 382245.ASA_3921 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  382245.ASA_3921
Domain Number 1 Region: 12-119
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000255
Family Anti-sigma factor antagonist SpoIIaa 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 382245.ASA_3921
Sequence length 125
Comment (Aeromonas salmonicida A449)
Sequence
MTMQLNNDLGIADVADCIVVSMRPDLGDDGMQMLMQALSQRLVHGRHHAVLLDFSGVMLL
DHHEFRQVRKRAEVCRLLGAICLLVGLNAGIAASLALAEAQPGPLRCFIDMDDAFAHVRH
LKGEE
Download sequence
Identical sequences A0A1Q4MFN5 A4SSK2
382245.ASA_3921 WP_005316320.1.10171 WP_005316320.1.13540 WP_005316320.1.2366 WP_005316320.1.28352 WP_005316320.1.29842 WP_005316320.1.36887 WP_005316320.1.40195 WP_005316320.1.41377 WP_005316320.1.46813 WP_005316320.1.49611 WP_005316320.1.51049 WP_005316320.1.51485 WP_005316320.1.52154 WP_005316320.1.53881 WP_005316320.1.57660 WP_005316320.1.5833 WP_005316320.1.62078 WP_005316320.1.75420 WP_005316320.1.79205 WP_005316320.1.86551 WP_005316320.1.8755 WP_005316320.1.91946 gi|145300781|ref|YP_001143622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]