SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 382638.Hac_0433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  382638.Hac_0433
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.55e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 382638.Hac_0433
Sequence length 186
Comment (Helicobacter acinonychis Sheeba)
Sequence
MLQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRVDDEPILN
HERFMQPDYVLVIDPGLVFIENIFADEKEDTTYIITSYLSKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
Download sequence
Identical sequences Q17YL1
gi|109947036|ref|YP_664264.1| 382638.Hac_0433 WP_011577379.1.79224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]