SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 382640.Btr_0856 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  382640.Btr_0856
Domain Number 1 Region: 138-418
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.83e-125
Family Enolase 0.0000000224
Further Details:      
 
Domain Number 2 Region: 3-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.53e-54
Family Enolase N-terminal domain-like 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 382640.Btr_0856
Sequence length 422
Comment (Bartonella tribocorum CIP 105476)
Sequence
MTIIVDIIGREVLDSRGNPTVEVDVYLENGAFGRALVPSGASTGAHEAIELRDGDLRYQG
KGVEKAVAAVNGEILEELGGRDARDQIAIDQAMIALDGTPNKARLGANALLGVSLAVAKA
AADSLNLPLYRYIGGTQAHILPTPMMNIINGGVHADNLIDFQEFMIIPVGAPSVKEAIRY
GAEIFHALKKRLKDAGYNTNVGDEGGFAPQFKSADQAIDFIMESIIACGYKPGEQIAIGL
DCASTEFYKNGSYFYKGEGKCRNIAEQVDYLAQLVKSYPIVTIEDGMAEDDWEGWKLLTD
TIGTKCQMVGDDLFVTNSARLRDGIKMGVGNSILIKVNQIGTLSETLDAVEVAHKAGYRA
IISHRSGETEDSFIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGSQARYAGDI
YR
Download sequence
Identical sequences A9IS50
WP_012231406.1.76171 WP_012231406.1.90605 382640.Btr_0856 gi|163868053|ref|YP_001609257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]