SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 383372.Rcas_1856 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  383372.Rcas_1856
Domain Number 1 Region: 250-357
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.16e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0049
Further Details:      
 
Weak hits

Sequence:  383372.Rcas_1856
Domain Number - Region: 175-246
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0217
Family Myosin rod fragments 0.015
Further Details:      
 
Domain Number - Region: 24-173
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit I-like 0.0634
Family Cytochrome c oxidase subunit I-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 383372.Rcas_1856
Sequence length 365
Comment (Roseiflexus castenholzii DSM 13941)
Sequence
MTHLFATLTNVTARNPDDQRRGRILVSLSLGVIALLLSVGMGLILLQPSVGRFGNLGLAV
LVFAVAAVLGKKGFVTAGAYVLIVVSGIGALSGVFLNPNSPFNTFYLLISVLLASVLLPP
RQIWVVLGICLAAVAGVLVRVPAETRTAINLDLASAHLTILLIVSAFISFIGARSLSSAL
KDVDESRRRAEEANRQIEVANATLEAHIEERTAAYRRLTDEQRAVVARLEESLRAQQHLN
QMIADLTVPVIPVRNDTLVIPLIGSIDASRVQQLLASALQSLERTRARILIIDVTGVAVI
DSHVAAALLQVAQAARLMGAETIVAGIRPEVAQTLISLGADLHSMRTAATLQSALAFTFN
GGDVQ
Download sequence
Identical sequences A7NKC7
383372.Rcas_1856 gi|156741836|ref|YP_001431965.1| WP_012120372.1.48654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]