SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 383372.Rcas_2308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  383372.Rcas_2308
Domain Number 1 Region: 222-493
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.08e-63
Family PFOR Pyr module 0.0072
Further Details:      
 
Domain Number 2 Region: 25-242
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-21
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.021
Further Details:      
 
Domain Number 3 Region: 506-596
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000157
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 383372.Rcas_2308
Sequence length 615
Comment (Roseiflexus castenholzii DSM 13941)
Sequence
MIQMPDTEIQPRPLDRPASEPIVNDFSIVAATVNGSGSQTANNVLMRAIFKMGVPVSGKN
LFPSNIQGLPTWFTIRVSKDGYTARRETTEILVAFNQRTADEDLASLVPGGVCVHPNDIT
FTNPRSDVSFYPLPVRDLVKQSGVDAKLRDYIANMVYVGALAELLSIDMNEIKAALERHF
KGKAKPVSLNYGVVVAAAEWVRANLPKTDRFQVAPMDKTQGLILVDGNTAAAFGALMGGM
TVCAWYPITPSTSLVDAMTELAPILRADPETNTTTYAIIQTEDEIAAAGIVVGAGWAGAR
AMTATSGPGLSLMNEFVSLAYFAEVPCVIWDVQRMGPSTGLPTRTSQGDVLSAYYMGHGD
THHVILFPGSMIECFEFGYLAFDLAERLQTPVLVLSDLDLGMNNWMSEPFTYPDRPLDRG
KVLSADELEKFKDWGRYKDIDGDGIPYRTLPGNPNPRAAYLARGTGHNEYAIYSERPQDW
QRNLDRLTRKHNTARTLVPKPVVQEAEDATIGIVAYGSTDPAVREACDMLRARGITASYL
RIRALPLEATLTDFLAKYERVYVVELNQDGQMAQLVQLHAPEYAARIRPIHICNGLPMSA
QFVVDSIVSAEHPVT
Download sequence
Identical sequences A7NLK0
383372.Rcas_2308 gi|156742280|ref|YP_001432409.1| WP_012120815.1.48654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]