SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 383372.Rcas_2371 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  383372.Rcas_2371
Domain Number 1 Region: 443-543
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.86e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 383372.Rcas_2371
Sequence length 604
Comment (Roseiflexus castenholzii DSM 13941)
Sequence
MLAMLKRLSLFQILQREFSTYDMAHFQRDLLAGLTVAAVGLPLALAFGVASGADAAAGLV
TAILAGLIIGGLGGAGYQISGPTGAMSAVLIVLASRYGLDGVWVATVMAGIFLIALGVFR
LGRYVSFIPSPVITGFTSGIALIIAIGQIDNVLGVTTPKAENALEKLWHYVTNPVVPDWH
TLALAGIVMGTMILLPRVTTRIPGSLVGIMIASPLAFFAGWDVAVIGDIPRTILLSNRLT
LESIPWEHLSELLPAAVSIAALGAIESLLCGTVGATMSGGEFDSNQELIGQGIGNLVIPF
FGGVPATAAIARTSVAIKSGAATRLTSIIHSLALLLSALALAPLISHVPLAALGDVLLVT
AWRMNEWESIHFFVRTRLRGALTGMIVTMIATAALDLTQAILIGVVISAVLYIRQSAIST
SVASGPVKPEKIRAQGFDLPAACPAIHVYYLTGPVFFGSVTTVLESFETAGDYHTLIISM
RGVPVVDAMGIQALQQIVEEHHHRGGKVYFSGLQPAVRSMFDRTGLTQLVGEEYIFWDAA
QAIIASHQSHELDGCAKCDSRSEICDVLRAARRRHVESDEAAAPAVATDSFPSTNMTSVS
SVQG
Download sequence
Identical sequences A7NLQ7
gi|156742342|ref|YP_001432471.1| 383372.Rcas_2371 WP_012120877.1.48654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]