SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 383372.Rcas_2495 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  383372.Rcas_2495
Domain Number 1 Region: 435-542
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.35e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0076
Further Details:      
 
Domain Number 2 Region: 339-387
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000144
Family HAMP domain 0.0094
Further Details:      
 
Weak hits

Sequence:  383372.Rcas_2495
Domain Number - Region: 374-430
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 383372.Rcas_2495
Sequence length 568
Comment (Roseiflexus castenholzii DSM 13941)
Sequence
MATSAHTTRPSLIGRDMSLRARLILGYGIIVSLTLIFGLFMLTYTRGVRNRLETLSADVT
IDTRYSIEAVTAVAEAQRALDRFLQQPNERHYQDAARQIDFLQRTIERLERDAHNPAMVG
HLRRIGNQAATYRQIFEETRNSIAARQRARDDLYTAFLQQYQTIEQAISNARPIAPSDYL
ALMDLSRASTRLQLAYVWIGRMESEDTATAADNALAELRQARTFLRRYLVLNTNPRIVRP
EDLERLQSVSESFDRSIISIASLSSASIRTEVLINSRLKPHAAQMSREATALSDTALMAL
SIAAVDISRETSQIRTIISSVLALLLIAGGALGVLLAALITRPLNELVAATARLARGEGA
LRVQPRGGRELILLAHAFNDMAAELERERAEIRRQNALLAERAAELEQTLHQLREETAAR
EQLSATVRQLSVPIIPIMEGVLVAPLVGEIDAERAQLLQQRLLHRIVTERAQVAILDITG
VPVVDGQISTWLIQATTAARLLGARCILVGINPEVSQALVASGIDLGDLATRATLREGLE
YAMRIMRAASGVRQEANGIRHATVRVRH
Download sequence
Identical sequences A7NM20
WP_012120999.1.48654 383372.Rcas_2495 gi|156742464|ref|YP_001432593.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]