SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 383372.Rcas_2553 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  383372.Rcas_2553
Domain Number 1 Region: 184-430
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-71
Family D-glucarate dehydratase-like 0.0000000483
Further Details:      
 
Domain Number 2 Region: 4-139
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-39
Family Enolase N-terminal domain-like 0.00000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 383372.Rcas_2553
Sequence length 434
Comment (Roseiflexus castenholzii DSM 13941)
Sequence
MAITITRAEARDVRFPTSRTLDGSDAMNPDPDYSAAYVILHTNVPGLTGHGLTFTIGRGN
ELCVAACQVLLPMVVNRSLESITADMGAFWHMITGDSQLRWIGPEKGVIHLATAAVVNAV
WDLWAKVEQKPLWKLLSDMSPEELVRCIDFRYISDALTPDEARDILRRQEATRAKREAEM
RTHGFPAYTTSAGWIGYSDDKVRRLCREAIDAGFQHIKMKVGRDLDADRRRARLIREIIG
PDRKLMADANQVWDVPQAIAWMRDLAEFDLWWIEEPTSPDDILGHAAIARAVAPVGVATG
EHVQNRIVFKQLLQMNAINFCQIDACRLGGVNEVLAVILMAAKFGVPVCPHAGGVGLCEY
VQHLSIWDYICVSASLENRVIEYVDHLHEHFLDPVVIRNARYMPPQTPGYSIEMKPESLA
MYEYPHGAAWSNLG
Download sequence
Identical sequences A7NM76
WP_012121055.1.48654 gi|156742520|ref|YP_001432649.1| 383372.Rcas_2553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]