SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 383372.Rcas_3848 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  383372.Rcas_3848
Domain Number 1 Region: 99-371
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.88e-86
Family D-glucarate dehydratase-like 0.0000442
Further Details:      
 
Domain Number 2 Region: 1-116
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.48e-30
Family Enolase N-terminal domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 383372.Rcas_3848
Sequence length 388
Comment (Roseiflexus castenholzii DSM 13941)
Sequence
MKITRVSTLVVHARMRNWVFVKVETDQDGLYGWGEATLEWKTKGVVGAVEDVSRLIIGED
PRRIEHLYQMMTRQYFWRAGIEGMTAMSGIEQALWDIKGKWLNVPVYELLGGRVRDRIRV
YNHLGGGTMEHMYETTDPDLFAERALMVKEQGYTALKFMAVPRTEPVEGMRPVRYAERLV
RAVRDAVGDDVDLMVDLHARCASPAMALRYCRAFEPYGLLFFEEPCPSEDIEATAQVTRA
SNIPIATGERLVGRHQFREVFERRACHIIQPDLSHCGGLWEARKIAAIAETYSMAVAPHN
PNGPIATAAAIHFAAATPNWVIQEAISNDVPWRYDVVDSEHQVRDGYIAIPSRPGLGVEV
NEGEAARHPWQPELVQRYFHPDGSVADW
Download sequence
Identical sequences A7NQN9
WP_012122308.1.48654 gi|156743774|ref|YP_001433903.1| 383372.Rcas_3848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]