SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 383372.Rcas_3855 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  383372.Rcas_3855
Domain Number 1 Region: 114-369
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.16e-72
Family D-glucarate dehydratase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 1-130
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.92e-31
Family Enolase N-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 383372.Rcas_3855
Sequence length 370
Comment (Roseiflexus castenholzii DSM 13941)
Sequence
MKITDVEAIWLQLPTVDDRADGTQDTLVVKVHTDEGIVGVGEVDSSPMAAKAIIEAPLSH
RIARGLRLCVIGEDPLDIARLWHAMYEGSIFFGRGGAAQQAISGIDIALWDIAGKALGQP
VYRLLGGGFRNRLRAYASILFQETPEATYDLARRLADQGFTAVKFGWGPMGTSEKTDLAL
VRMARRGLGDHLDLMIDAGICYDTATAIRRAHQFAEYNPFWLEEPLHPDNLEGYSRLAAV
SPIRIAAGEQETTLVGFQALLDAGLAVVQPDVARVGGISQAIQIGRMAMQRHRLCVNHSY
KTGISIAASLHFLAALPNAPLLEYCVEQSPLRQTLTRETFPVVDGWVAVPQEPGLGITLD
EEVIARYRVA
Download sequence
Identical sequences A7NQP6
gi|156743781|ref|YP_001433910.1| 383372.Rcas_3855 WP_012122315.1.48654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]