SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 383372.Rcas_3857 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  383372.Rcas_3857
Domain Number 1 Region: 203-312
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.3e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0056
Further Details:      
 
Weak hits

Sequence:  383372.Rcas_3857
Domain Number - Region: 16-155
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0471
Family Glycerol-3-phosphate transporter 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 383372.Rcas_3857
Sequence length 316
Comment (Roseiflexus castenholzii DSM 13941)
Sequence
MIRLTQRQINHGVFGLLNGLALIAIGFSIFPTPQWHAIIPVLAGLAFGSSLWFAYWRGWE
PARPLLILLLTVIVALGTAETFIATRFNHTLYTIPALALVLTGPVWVAGSALTLLVAFAI
RGGGGPYLNPFELLTFVLVIGGMIFSRLAVDNAQRLEAAKREAEEARTRAEQRERDLAAQ
AEELAQRNVEQQRLLELVSALETPTIALAESVLLAPIVGALDTRRAQALTTRLLNDASAQ
RAQHVILDISGVTAVDTQVAQALIQTARALSLIGCRVTLTGISATVAMTLTNLGVALESI
HTVRSPQEALAARTEN
Download sequence
Identical sequences A7NQP8
383372.Rcas_3857 gi|156743783|ref|YP_001433912.1| WP_012122317.1.48654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]