SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 383372.Rcas_4213 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  383372.Rcas_4213
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000051
Family Anti-sigma factor antagonist SpoIIaa 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 383372.Rcas_4213
Sequence length 114
Comment (Roseiflexus castenholzii DSM 13941)
Sequence
MTNEMNEVIRREEFGDVAVLHIMTNSVDAVSASAIEAVATATAMRPITVLDFANVSFINS
AGISALLKFVVSAKKSGYTLYAMNVTPHHQKVFKMVEMSRYMPPIEERDLAAYR
Download sequence
Identical sequences A7NRP4
383372.Rcas_4213 gi|156744129|ref|YP_001434258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]