SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 383372.Rcas_4345 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  383372.Rcas_4345
Domain Number - Region: 175-238
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00326
Family Rad21/Rec8-like 0.053
Further Details:      
 
Domain Number - Region: 104-156
Classification Level Classification E-value
Superfamily PX domain 0.0379
Family PX domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 383372.Rcas_4345
Sequence length 254
Comment (Roseiflexus castenholzii DSM 13941)
Sequence
MFIEPIDYTVTLPIFEGPLDLLLRLIEREELDVTGVALAHVADQYLAHVRTMDAPDPASL
SAFLVVAARLMLLKSRALLPRPSIISDQEPDDEGESLVRQLQEYQRFRRLAALLRRSEGQ
RMYPRLAMPPAPRPARLDHTIADLIAAMQRRMQLMLPLDPPPMTLPAPKMVTVGEMIDRI
RSYLQERPWVAFEEMIALAAHRVEIVVAFWAVLELWKRHVVVVEQAGLFGVIVIRRGVLF
GKEELRTETRELTG
Download sequence
Identical sequences A7NS23
383372.Rcas_4345 WP_012122790.1.48654 gi|156744258|ref|YP_001434387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]