SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 384616.Pisl_0497 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  384616.Pisl_0497
Domain Number 1 Region: 8-181
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.48e-41
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 384616.Pisl_0497
Sequence length 184
Comment (Pyrobaculum islandicum DSM 4184)
Sequence
MYVIRNAMYEVIFLGRGGQGAVTAVQLLAHAAALEGKKAQALPEFGAERRGAIVKAYLRI
GEVLLHSSIKKADYVIVLDGRIIDQIDVKQYGKEGATYIVNTKNPADWYISIDATSIALK
HGLVVAGWPVVNLIMAAAFAAVSGAVSLESLLKATAEYVPKRYLEANIKAIVETYDIVKK
LKIS
Download sequence
Identical sequences A1RRU3
gi|119872011|ref|YP_930018.1| 384616.Pisl_0497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]