SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 384616.Pisl_1056 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  384616.Pisl_1056
Domain Number 1 Region: 16-179
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.16e-23
Family Clp protease, ClpP subunit 0.041
Further Details:      
 
Domain Number 2 Region: 366-425
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000366
Family NfeD domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 384616.Pisl_1056
Sequence length 438
Comment (Pyrobaculum islandicum DSM 4184)
Sequence
MKKWILLLLLTCFSNAYIVHTIYTVEINGIIGPYTLSQIERAISLAEQNNGLVLLLLSTP
GGLADVTLQIMKEVGNSPVPVVGFVYPDYSYAWSAGTYVLMSTHIAAMAPHTVIGSCQPI
AGGTPVNESKTLNALIGYLETVAKSYGRNGTFARLCITKNVNLGADEALRYKVIDIIAND
IDDLLRKINGSSIVLRNQRVEIVVIGSAIQPVTPTPTETLQMWLSDPVVSSILSLLAFIL
LLTAFLTGHPAAIVAAIILLVVSMFSILPTAWLSLVLIIMGASLIVFEILAGMAAHGVVA
GVGAVLVIIGFLSAYPASVFGRELIHIKDWWLIQLGLYINIAVLVGFIGLIIYKAVAVHK
VKPPSEFLTNLRGMEGVALDDIEPGVPGFVKVFGEYWKAVSDVSIKRGCKIRVLEVQGDR
LKVEPAGINTPEGTEGEK
Download sequence
Identical sequences A1RTE7
WP_011762804.1.84334 gi|119872565|ref|YP_930572.1| 384616.Pisl_1056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]