SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 384616.Pisl_1175 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  384616.Pisl_1175
Domain Number 1 Region: 252-520
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.13e-52
Family PFOR Pyr module 0.085
Further Details:      
 
Domain Number 2 Region: 535-644
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 7.42e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.042
Further Details:      
 
Domain Number 3 Region: 19-273
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000000602
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 384616.Pisl_1175
Sequence length 650
Comment (Pyrobaculum islandicum DSM 4184)
Sequence
MATILIKNINMYIILVLMKISFLIGGPQGRGVETASFMFIYGVGAAGYYVYARREFWSNI
AGGRHSYVVGTISENWPAPAPGNSVELALTFDGHAVLEHIHHLKKGSFLVYNTEEDPKTP
DSYQMLAKPLAERLKKFAKEHGFEPTVKGFVEYLRQNGVEVLGLPYNKHISEIGRKIGVT
SPVMLARFVNTFVVALGAALLGLDEEYVARGVGFALGRKAEVIEQNKKIAAEAIKLVDKR
ITTLKPRNPGVKRIFWNGNEASGYGKVVGGIRFVAYYPITPATDDAMTFERLIPFPVDRN
AGELAKFEKIGAMAFQAEDELSAIAIATGGAIAGARAATVTSGPGFSLMAEALSMAGMME
VGVVVTVWMRAGPSTGQATRQAQQDLLFSLFIGHGEYPKIVYASGDLEEVFLDNIRVANW
AERYRVPVIHLVDKNLSNTFAVMPLPDPAKVKIQTEKPVVFPQTKDAEAYPLEEILPPKL
LPGISNAIFHLNSLEHDPEGDPEEDPVVVTKMFERRMAKLKLIESEISPEEKVLYFGPQD
AKRVIVGWGSVKPAVLTALEELKDVGFLYVKMLYPYPVELVKKYLQGRETLFIENNYLGQ
LAMITQMFAGIEPTAVAVKFNGRPITTDDVIYAYRKFVEGQKTIKIETDL
Download sequence
Identical sequences A1RTR1
384616.Pisl_1175 gi|119872679|ref|YP_930686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]