SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 384616.Pisl_1247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  384616.Pisl_1247
Domain Number 1 Region: 162-275
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000264
Family Ribosomal protein L11 methyltransferase PrmA 0.081
Further Details:      
 
Domain Number 2 Region: 57-114
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000536
Family NfeD domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 384616.Pisl_1247
Sequence length 280
Comment (Pyrobaculum islandicum DSM 4184)
Sequence
MDVVVSASILGLLGGLIAVFTFLGSIPPWLGYSVGGTLLSIYAIIVIAGLRAPRDKRSPL
DIIGKRGIVAGVENGWAIVKIEGVYWRAYCIGCLPGDVVEVVEVGDTGLVVKKIMIWLVI
FTAALVIILHFIWPFVVRRGGAYSTSSAEAALWAFKRIGVYGKKVYDLGCGYGRVLTLAK
RLGAVVVGVEIDPLRWFICVLRCRCKVLLGDMFKIPLSDADVVYIFQWPSVNIRLAVKFM
RELRRDAFVVSYMWEVPGLKLVEHNPELRVYIYRVGESNF
Download sequence
Identical sequences A1RTY0
384616.Pisl_1247 gi|119872748|ref|YP_930755.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]