SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 384676.PSEEN0032 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  384676.PSEEN0032
Domain Number 1 Region: 426-510
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000051
Family Anti-sigma factor antagonist SpoIIaa 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 384676.PSEEN0032
Sequence length 521
Comment (Pseudomonas entomophila L48)
Sequence
MPRPHHLLPFLAWLPRQSGRSLRQDLLVGLSGAILALPQSIAYALIAGLPAEYGLYAAIV
PVLVACLWGSSWHLICGPTAAISIVLYASISPLAVAGSADYVTLVLLLTFLGGVFQLMLG
LLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGLDLPSQATALKTVQELTGHVGEV
DMPSLILGLSTLVIGVVLKLWRPRWPSLLISLLLVSLAAWLLPGVFGHVPRVPAFVGQLP
PLSPLPLLDVELILRLLPSAVAVGMLGLVTSLSIARSLSARSEQLIDANQEIRAQGLSNI
VGALFSGYLSSGSFTRSGLSYDAGARSPLAGVFSALWVTLFAVAGAGLIAHLPIPAMAGS
ILLICWGLVDHRGIRALFRVSRSEFLVMALTAAATLLLELQTAIYAGVLASLFFYLKRTS
RPRVQQSREGEADVLRVGGSIFFGAAHYLQVRLQRCQGPHVVIDARQVNFIDYSGVDMLH
REARRLLRNGGSLTLRRARPQVIEELQKLEGLASCPIRFEG
Download sequence
Identical sequences Q1IH26
384676.PSEEN0032 WP_011531487.1.45913 gi|104779345|ref|YP_605843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]