SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 384676.PSEEN0731 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  384676.PSEEN0731
Domain Number 1 Region: 145-420
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.02e-84
Family D-glucarate dehydratase-like 0.000000000753
Further Details:      
 
Domain Number 2 Region: 13-143
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.88e-33
Family Enolase N-terminal domain-like 0.00000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 384676.PSEEN0731
Sequence length 451
Comment (Pseudomonas entomophila L48)
Sequence
MNLQTTPQAHLGTPVVTDLRVVPVAGHDSMLLNLSGAHGPFFTRNIVVLRDSAGNTGLGE
VPGGEKIRQTLEDARALVVGQPIGHYQRVLNAMRQTFANRDAGGRGLQTFDLRITVHAVT
AMESALLDLLGQHLGVPMAALLGEGQQREAVKMLGYLFYIGDRQRTDLAYRNEADADDAW
FRLRHEQALTPEAVVRLAEAAKARYGFNDFKLKGGVLRGEEEMEAVIALAERFPDARITL
DPNGAWSLQEAIALCRDKHQVLAYAEDPCGAENGYSGREVMAEFRRATGLPTATNMIATD
WRQMGHAIQSQAVDIPLADPHFWTLQGSVRVAQMCHDWGLTWGSHSNNHFDISLAMFTQV
AAAAPGEITAIDTHWIWQDGQRLTREPLRIVEGHVRVPERPGLGVELDEDQLAKAHACYR
TMGLGARDDSVAMQYLVPGWAFDNKRPCLVR
Download sequence
Identical sequences Q1IF98
384676.PSEEN0731 gi|104779973|ref|YP_606471.1| WP_011532088.1.45913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]