SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 384676.PSEEN3163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  384676.PSEEN3163
Domain Number 1 Region: 23-137
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.0000000000000549
Family Regulatory protein AraC 0.013
Further Details:      
 
Domain Number 2 Region: 222-270
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000103
Family AraC type transcriptional activator 0.013
Further Details:      
 
Domain Number 3 Region: 171-219
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000233
Family AraC type transcriptional activator 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 384676.PSEEN3163
Sequence length 271
Comment (Pseudomonas entomophila L48)
Sequence
MSSSSSEIWHDPALPHVESRRACHSRACYKAHSHPTFSIGAVDAGCSRFTGAGVGEVRLT
PGTLVLVPAQRVHACNPEPGQAWSYQMLHLDADWLRGLRLESGVAAGEPGAPARISVSRG
LYRQFCALNALLFSPAAPIEKDAALVTFIGDHDFSGHPALRPAPPLPPSILQELVARVDD
DDLATLNLDRLAQQAQLGRYQLIRAFAAATGMTPHAYLLNARVSKARQLLRQGHGLAEVA
YKLGFADQSHFQRVFKAHAGVTPGAYRRAHL
Download sequence
Identical sequences Q1I8V1
WP_011534314.1.45913 384676.PSEEN3163 gi|104782220|ref|YP_608718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]