SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 384676.PSEEN4200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  384676.PSEEN4200
Domain Number 1 Region: 143-427
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.24e-129
Family Enolase 0.00000000312
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.35e-55
Family Enolase N-terminal domain-like 0.000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 384676.PSEEN4200
Sequence length 429
Comment (Pseudomonas entomophila L48)
Sequence
MAKIVDIKGREVLDSRGNPTVEADVLLDNGIIGSACAPSGASTGSREALELRDGDKSRYL
GKGVLKAVANINGPIRDLLLGKDPADQKALDRAMIELDGTENKAKLGANAILAVSLAAAK
AAAQDLDLPLYAHIANLNGTPGQYSMPVPMMNIINGGEHADNNVDIQEFMVQPVGAKTFS
DGLRMGTEIFHHLKAVLKARGLNTAVGDEGGFAPNLASNEDALGAIAEAVEKAGYKLGTD
VTLALDCAASEFYEDGKYNLSGEGKSFDAEGFADYLKGLTERFPIISIEDGLDESDWAGW
KILTDKIGEKVQLVGDDLFVTNTKILKEGIEKGIGNSILIKFNQIGSLTETLEAIQMAKA
AGYTAVISHRSGETEDSTIADLAVGTAAGQIKTGSLCRSDRVSKYNQLLRIEEQLGAKAV
YRGRAEFRG
Download sequence
Identical sequences Q1I646
gi|104783175|ref|YP_609673.1| 384676.PSEEN4200 WP_011535260.1.45913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]