SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 386043.lwe0339 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  386043.lwe0339
Domain Number 1 Region: 34-90
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000262
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 386043.lwe0339
Sequence length 99
Comment (Listeria welshimeri serovar 6b SLCC5334)
Sequence
MKHNFTEDDFVYGESWGLVHRGVLEDKEIDRMKALRDKVVGKKGVAATTLKPIGSVRIDG
EVYEARLKTGYLEVGKPIIAVGIDFGYILVNEDIQEGEK
Download sequence
Identical sequences A0AFH5
gi|116871759|ref|YP_848540.1| 386043.lwe0339 WP_011701192.1.63932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]