SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 386043.lwe0485 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  386043.lwe0485
Domain Number 1 Region: 439-548
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000104
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 386043.lwe0485
Sequence length 553
Comment (Listeria welshimeri serovar 6b SLCC5334)
Sequence
MFKHVLLSLNGYKASYLRNDVISGVGVAALTIPVAMGYAQVAGLPPIYGLYASFLPVLAY
IIFASSPQLIFGIDATASAITGSIILGTAGLAAGSKEAIALAPILAFFCAIFLVLFSILK
LGRFAKYISAPVLSGFISGLSVSIIMGQIPKIMGLKESGDSFFSSLGIIFGQFFQSNWIS
FAMGVVTVIIVITCKKVIPKIPMSLVVLVLGTMAAYFFKLDQYNVDIVGKIPVGFPSLAL
PDFGASSWALAIGGGLVCAIATFAGSLLPSESFAMRNKYTIDDNRELFAYGISNFVAAFS
GCSPASASVSRTAANEQFRGKTQMVSIVAASIIALIVAFLSGLLYYMPQPVLSGIVFSAL
VGIIDVDILKGLFRVSRREAIVWIVAAIGTLLVGVIFGVLLGIILSFINVVSRSMKSPVA
VLGVIDGRHGYFDLKRKPEAKAIPNVIIYRYSASLFFGNFNKFADGLKEAIQDDTKLVIF
ESSAIINIDTTATESMKDLLKWLDDKGIEYYFADLIDHLKTSFRKHDLGYIIDEGYTKKT
VEDALDAYHAKHK
Download sequence
Identical sequences A0AFX1
gi|116871905|ref|YP_848686.1| WP_011701331.1.63932 386043.lwe0485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]