SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 386415.NT01CX_0102 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  386415.NT01CX_0102
Domain Number 1 Region: 81-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000144
Family NfeD domain-like 0.0052
Further Details:      
 
Weak hits

Sequence:  386415.NT01CX_0102
Domain Number - Region: 11-76
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00889
Family Glycerol-3-phosphate transporter 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 386415.NT01CX_0102
Sequence length 141
Comment (Clostridium novyi NT)
Sequence
MRFQIILWIIIAILSLIIDISTSSFLFVWFTIGGVIASILSLMNFSFTIQIITFIITSIV
LMVICYPIIKRTIKKTVPTTSTMEEEYIGDEFIIKRDVESKAIIKYNGIYWTVKSVQGKI
EKGSTVKIVGIEGNKLLIKKI
Download sequence
Identical sequences A0A072X166 A0Q1V9
386415.NT01CX_0102 gi|118444057|ref|YP_878611.1| WP_011722601.1.12664 WP_011722601.1.24188 WP_011722601.1.42769 WP_011722601.1.57937 WP_011722601.1.66291 WP_011722601.1.95864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]