SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 386415.NT01CX_0147 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  386415.NT01CX_0147
Domain Number 1 Region: 6-190
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-52
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 386415.NT01CX_0147
Sequence length 194
Comment (Clostridium novyi NT)
Sequence
MDKKLIEIRWHGRGGQGAKTASLLLAEVAFNTGMYIQGFPEYGPERMGAPITAYNRIANF
PLRVHSNIYEPDFVVVVDESLLKSVNCVAGLKKEGAIIINTKKSIDEIRKELCGYEGKVY
TIDARTISEETLGAYFPNTPMLAAIVKVLGIMDLDEFIEDMKDSFKHKFASKPQVISKNM
NALKRSLQEVNGIE
Download sequence
Identical sequences A0Q204
386415.NT01CX_0147 gi|118444651|ref|YP_878656.1| WP_011722645.1.12664 WP_011722645.1.66291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]