SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 386415.NT01CX_1804 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  386415.NT01CX_1804
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.07e-28
Family Anti-sigma factor antagonist SpoIIaa 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 386415.NT01CX_1804
Sequence length 111
Comment (Clostridium novyi NT)
Sequence
MNLVFEEREDILIVHMEGELDHHTAEEVRSRIDDRIDRTRFYKVIMDFTNVNFMDSSGIG
VVIGRYKKLLLKKGKINMIGAKGAVKRVFELSGMFKIIPLYDSLQDAMENI
Download sequence
Identical sequences A0A072X422 A0PZS5
386415.NT01CX_1804 gi|118444491|ref|YP_877877.1| WP_011721882.1.12664 WP_011721882.1.24188 WP_011721882.1.42769 WP_011721882.1.57937 WP_011721882.1.66291 WP_011721882.1.95864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]