SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 386415.NT01CX_1854 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  386415.NT01CX_1854
Domain Number 1 Region: 785-1167
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.9e-133
Family PFOR PP module 0.00000000215
Further Details:      
 
Domain Number 2 Region: 415-667
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.44e-89
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000041
Further Details:      
 
Domain Number 3 Region: 3-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.03e-79
Family PFOR Pyr module 0.0000000131
Further Details:      
 
Domain Number 4 Region: 258-409
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.28e-52
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000817
Further Details:      
 
Domain Number 5 Region: 664-829
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.21e-20
Family Ferredoxin domains from multidomain proteins 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 386415.NT01CX_1854
Sequence length 1168
Comment (Clostridium novyi NT)
Sequence
MAKMKTMDGNTAAAYTSYAFTDVTAIYPITPSSPMAESVDEWSAQGKKNLFGQTVKVMEL
QSEAGASAAVHGSLQSGALTTTYTASQGLLLMIPNMYKIAGELLPSVFHVSARALASHAL
SIFGDHQDVMAARQTGFALLASNSVQESMDLAAVAHLAALKGRVPFVHFFDGFRTSHEIQ
KVELLDYEDLRGLIDQDALKAFRNNALSPEHPVTRGTAQNPDIFFQAREASNKYYNAIPG
IVEEYMGEINKITGRDYKLFNYYGAEDADRVIVAMGSGCETIEEVVDYLSARGEKVGLVK
VHLYRPFSKEHLINAVPKTVKKIAVLDRTKEPGALGEPLYLDVKSAFYDVENKPVIVGGR
YGLGSKDTTPGQMAAVFENLKQDEPKNNFTLGINDDVTHTSLETVEGIDVVAEGTTACKF
WGLGSDGTVGANKSAIKIIGDHTDMYAQGYFAYDSKKSGGITISHLRFGKSPIKSPYLIQ
TPHFVACHNQSYVNKYDVLEGLRDNGNFLLNCIWNQEEVEEHLPAHMKRYIANHNINFYT
IDAVKIAQEIGLGGRINMIMQAAFFKLANIIPIEDAVKYLKDAVVTSYGKKGEKVVNMNH
AAIDQGVGAIVKVEVPESWKTAEDKKVEEKDVPEFISKILEPMNRQKGDELPVSAFEGME
DGTFPNGTAAYEKRGIAISVPEWSMENCIQCNQCSYVCPHAVIRPTLLTEEEYNNKPEGF
KAVEAKGIKGEKLYYAMNVSVLDCTGCGNCAEVCPAPTKALVMKPAATQEAEQANYDYAQ
TLSVKENPMDKYTVKGSQFEKPLLEFHGACGGCGEAAYAKLITQLFGDRMMIANATGCTS
IWGGSAPATPYTKNHEGKGPAWANSLFEDNAEYGLGMALGVSTIRTNMENVAKEAMEEVS
AELKSALQEWVDNKEDAEGSKKAAAKLLPLLEAEKSNAKVAEILENKDFLIKRSQWIFGG
DGWAYDIGYGGVDHALASGEDINIFVFDTEVYSNTGGQSSKSTRTGAVAKFAAAGKRTKK
KDLGLMAMTYGYVYVAQIAMGSDKNQTIKAIKEAEAYPGPSLIIAYAPCINHGLKVGMAC
SQLEEKKAVDCGYWGLYRYNPQLKEEGKNPFILDSKEPKGNFKDFLLGEVRYASLKKARP
EQADELYAQTEKDAMERLETYKRLAEDK
Download sequence
Identical sequences A0PZX5
gi|118443355|ref|YP_877927.1| WP_011721931.1.12664 WP_011721931.1.66291 386415.NT01CX_1854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]