SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 386585.ECs2000 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  386585.ECs2000
Domain Number 1 Region: 794-1166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.14e-118
Family PFOR PP module 0.0000000338
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.85e-77
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000128
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2e-71
Family PFOR Pyr module 0.0000000964
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.86e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000197
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.7e-23
Family Ferredoxin domains from multidomain proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 386585.ECs2000
Sequence length 1174
Comment (Escherichia coli O157H7)
Sequence
MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
AGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAANVQEAQDFALISHIATLKSRVPFIHFFDGFRTSHEINKIV
PLADDTILDLMPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
QAMNDFSAATGRQYQPFEYYGHPQAERVIILMGSAIGTCEEVVDELLTRGEKVGVLKVRL
YRPFSAKHLLQALPGSVRSVAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRVI
GGRYGLSSKEFGPDCVLAVFAELNAAKPKARFTVGIYDDVTNLSLPLPENTLPNSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEQPIRSAYL
ISQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSTDEVWSRLPQEVQAVLNQKKARF
YVINAAKIARECGLAARINTVMQMAFFHLTQILPGDSALAELQGAIAKSYSSKGQDLVER
NWQALALARESVEEVPLQPVNPHSANRPPVVSDAAPAFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNHCVAACPHSAIRAKVVPPEAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KINYDFFLNLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHRVRVLRL
LDQFADKIPAELLTALKSDATPEVRREQVAALRQQLNDVAEAHELLRDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKLPLALDSRPPSEALEETLLHEQRFRRLNSQQP
EVAEQLWKDAAADLQKRYDFLAQMAGKAEKSNTD
Download sequence
Identical sequences A0A0F6C3U6 A0A0H3JDU8 A0A2J9MRR4 C3TB83
386585.ECs2000 gi|15831254|ref|NP_310027.1| gi|387882410|ref|YP_006312712.1| NP_310027.1.58667 WP_000628197.1.10010 WP_000628197.1.100299 WP_000628197.1.10206 WP_000628197.1.10761 WP_000628197.1.1111 WP_000628197.1.12305 WP_000628197.1.12552 WP_000628197.1.13060 WP_000628197.1.13217 WP_000628197.1.13332 WP_000628197.1.13430 WP_000628197.1.14748 WP_000628197.1.15702 WP_000628197.1.16075 WP_000628197.1.16133 WP_000628197.1.16845 WP_000628197.1.18136 WP_000628197.1.1834 WP_000628197.1.20449 WP_000628197.1.20941 WP_000628197.1.22251 WP_000628197.1.22925 WP_000628197.1.23073 WP_000628197.1.23115 WP_000628197.1.23241 WP_000628197.1.23323 WP_000628197.1.23467 WP_000628197.1.23790 WP_000628197.1.23838 WP_000628197.1.23899 WP_000628197.1.23984 WP_000628197.1.24283 WP_000628197.1.25076 WP_000628197.1.25088 WP_000628197.1.25201 WP_000628197.1.25305 WP_000628197.1.25577 WP_000628197.1.25794 WP_000628197.1.25831 WP_000628197.1.26121 WP_000628197.1.26134 WP_000628197.1.26474 WP_000628197.1.29126 WP_000628197.1.29564 WP_000628197.1.29597 WP_000628197.1.30476 WP_000628197.1.30993 WP_000628197.1.30999 WP_000628197.1.31055 WP_000628197.1.3140 WP_000628197.1.31401 WP_000628197.1.32063 WP_000628197.1.322 WP_000628197.1.32574 WP_000628197.1.32888 WP_000628197.1.33094 WP_000628197.1.33167 WP_000628197.1.33268 WP_000628197.1.34686 WP_000628197.1.3550 WP_000628197.1.36212 WP_000628197.1.36626 WP_000628197.1.36767 WP_000628197.1.37372 WP_000628197.1.3762 WP_000628197.1.37731 WP_000628197.1.38107 WP_000628197.1.389 WP_000628197.1.39310 WP_000628197.1.39601 WP_000628197.1.40234 WP_000628197.1.4030 WP_000628197.1.40952 WP_000628197.1.4103 WP_000628197.1.41734 WP_000628197.1.42447 WP_000628197.1.43384 WP_000628197.1.43536 WP_000628197.1.43754 WP_000628197.1.43798 WP_000628197.1.43837 WP_000628197.1.43939 WP_000628197.1.44733 WP_000628197.1.44906 WP_000628197.1.44954 WP_000628197.1.45020 WP_000628197.1.45076 WP_000628197.1.45293 WP_000628197.1.45841 WP_000628197.1.46369 WP_000628197.1.46414 WP_000628197.1.46451 WP_000628197.1.46597 WP_000628197.1.46810 WP_000628197.1.4708 WP_000628197.1.47140 WP_000628197.1.47784 WP_000628197.1.47827 WP_000628197.1.47994 WP_000628197.1.48258 WP_000628197.1.48697 WP_000628197.1.48712 WP_000628197.1.48806 WP_000628197.1.49332 WP_000628197.1.49567 WP_000628197.1.50345 WP_000628197.1.50762 WP_000628197.1.51171 WP_000628197.1.51505 WP_000628197.1.51693 WP_000628197.1.51834 WP_000628197.1.55838 WP_000628197.1.5639 WP_000628197.1.56392 WP_000628197.1.56491 WP_000628197.1.56554 WP_000628197.1.57032 WP_000628197.1.57071 WP_000628197.1.58423 WP_000628197.1.58723 WP_000628197.1.59038 WP_000628197.1.59470 WP_000628197.1.60304 WP_000628197.1.60461 WP_000628197.1.60744 WP_000628197.1.60761 WP_000628197.1.61099 WP_000628197.1.61623 WP_000628197.1.62675 WP_000628197.1.63615 WP_000628197.1.64086 WP_000628197.1.64161 WP_000628197.1.64946 WP_000628197.1.65035 WP_000628197.1.65875 WP_000628197.1.65963 WP_000628197.1.66566 WP_000628197.1.67214 WP_000628197.1.67676 WP_000628197.1.67780 WP_000628197.1.68096 WP_000628197.1.6887 WP_000628197.1.69818 WP_000628197.1.70123 WP_000628197.1.70576 WP_000628197.1.71099 WP_000628197.1.71205 WP_000628197.1.71269 WP_000628197.1.71448 WP_000628197.1.71840 WP_000628197.1.72322 WP_000628197.1.72427 WP_000628197.1.72641 WP_000628197.1.73801 WP_000628197.1.73968 WP_000628197.1.7446 WP_000628197.1.76189 WP_000628197.1.76407 WP_000628197.1.77239 WP_000628197.1.77644 WP_000628197.1.77760 WP_000628197.1.77961 WP_000628197.1.7799 WP_000628197.1.78593 WP_000628197.1.7940 WP_000628197.1.79576 WP_000628197.1.79715 WP_000628197.1.80309 WP_000628197.1.80330 WP_000628197.1.80578 WP_000628197.1.81070 WP_000628197.1.81420 WP_000628197.1.81442 WP_000628197.1.81975 WP_000628197.1.82057 WP_000628197.1.82296 WP_000628197.1.82594 WP_000628197.1.84219 WP_000628197.1.84264 WP_000628197.1.84657 WP_000628197.1.8477 WP_000628197.1.85722 WP_000628197.1.86574 WP_000628197.1.86994 WP_000628197.1.87616 WP_000628197.1.88528 WP_000628197.1.88891 WP_000628197.1.89569 WP_000628197.1.90848 WP_000628197.1.91088 WP_000628197.1.91356 WP_000628197.1.92819 WP_000628197.1.93069 WP_000628197.1.93428 WP_000628197.1.94676 WP_000628197.1.98176 WP_000628197.1.98205 WP_000628197.1.99234 WP_000628197.1.99487 WP_000628197.1.99501 WP_000628197.1.99692 WP_000628197.1.99986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]