SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 386585.ECs3647 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  386585.ECs3647
Domain Number 1 Region: 139-156,184-446
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.15e-116
Family D-glucarate dehydratase-like 0.00000563
Further Details:      
 
Domain Number 2 Region: 11-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.3e-38
Family Enolase N-terminal domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 386585.ECs3647
Sequence length 446
Comment (Escherichia coli O157H7)
Sequence
MSSQFTTPVVTEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEK
IRKTLEDAIPLVVGKTLGEYKNVLTLVRNTFADRDAGGRGLQTFDLRTTIHVVTGIEAAM
LDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGNRKATPLPYQSQPDDSCDWYRLRHE
EAMTPDAVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAQRFPQARITLDPNGAW
SLNEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGH
TLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAMFTHVAAAAPG
KITAIDTHWIWQEGNQRLTKEPFEIKGGLVQVPEKPGLGVEIDMDQVMKAHELYQKHGLG
ARDDAMGMQYLIPGWTFDNKRPCMVR
Download sequence
Identical sequences A0A023Z1L8 A0A024KP97 A0A025CW05 A0A069XF41 A0A070ST38 A0A0E0U311 A0A0F6C8A3 A0A0F6FBG3 A0A0H3PVW5 A0A0M7NER8 A0A1S9J2N2 A0A1X3II30 A0A1X3LF61 A0A1Z3V0E7 A0A236TCF7 A0A2H1BGP2 C3SX32 D3QPY6 D6ICL8 E3PHU4 H4UN45 L2VHR3 L3C507 L4V865 M9G3P6 P0AES2 P0AES3 S1HY48 T9CTT4 T9TEE4 V2RNZ3
316385.ECDH10B_2955 316407.gudD 386585.ECs3647 444450.ECH74115_4047 511145.b2787 544404.ECSP_3739 595496.BWG_2525 gi|209397778|ref|YP_002272252.1| gi|386706047|ref|YP_006169894.1| gi|238901925|ref|YP_002927721.1| gi|471334406|ref|YP_007557883.1| 1ec7_A 1ec7_B 1ec7_C 1ec7_D 1ec8_A 1ec8_B 1ec8_C 1ec8_D 1ec9_A 1ec9_B 1ec9_C 1ec9_D 1ecq_A 1ecq_B 1ecq_C 1ecq_D 4gyp_A 4gyp_B gi|387508143|ref|YP_006160399.1| gi|15832901|ref|NP_311674.1| gi|387883967|ref|YP_006314269.1| gi|387622470|ref|YP_006130098.1| gi|170082358|ref|YP_001731678.1| NP_311674.1.58667 NP_417267.1.90541 WP_000098255.1.10001 WP_000098255.1.100073 WP_000098255.1.10010 WP_000098255.1.100111 WP_000098255.1.100159 WP_000098255.1.100299 WP_000098255.1.100302 WP_000098255.1.100444 WP_000098255.1.100487 WP_000098255.1.100508 WP_000098255.1.100554 WP_000098255.1.100753 WP_000098255.1.100803 WP_000098255.1.10086 WP_000098255.1.100925 WP_000098255.1.10094 WP_000098255.1.100966 WP_000098255.1.101033 WP_000098255.1.101105 WP_000098255.1.101158 WP_000098255.1.101166 WP_000098255.1.101206 WP_000098255.1.101282 WP_000098255.1.101628 WP_000098255.1.101737 WP_000098255.1.101777 WP_000098255.1.10187 WP_000098255.1.10188 WP_000098255.1.101908 WP_000098255.1.101977 WP_000098255.1.10206 WP_000098255.1.102094 WP_000098255.1.102139 WP_000098255.1.10252 WP_000098255.1.10273 WP_000098255.1.10304 WP_000098255.1.10335 WP_000098255.1.1040 WP_000098255.1.10417 WP_000098255.1.10476 WP_000098255.1.10524 WP_000098255.1.10569 WP_000098255.1.10729 WP_000098255.1.10761 WP_000098255.1.10824 WP_000098255.1.10833 WP_000098255.1.10970 WP_000098255.1.11047 WP_000098255.1.11052 WP_000098255.1.1111 WP_000098255.1.11118 WP_000098255.1.1113 WP_000098255.1.11240 WP_000098255.1.11241 WP_000098255.1.11301 WP_000098255.1.11418 WP_000098255.1.11420 WP_000098255.1.11436 WP_000098255.1.11542 WP_000098255.1.11671 WP_000098255.1.1168 WP_000098255.1.11690 WP_000098255.1.11844 WP_000098255.1.11982 WP_000098255.1.1212 WP_000098255.1.12259 WP_000098255.1.12305 WP_000098255.1.12319 WP_000098255.1.12352 WP_000098255.1.12458 WP_000098255.1.12552 WP_000098255.1.12582 WP_000098255.1.12646 WP_000098255.1.127 WP_000098255.1.12756 WP_000098255.1.12766 WP_000098255.1.12914 WP_000098255.1.13031 WP_000098255.1.13060 WP_000098255.1.1312 WP_000098255.1.13136 WP_000098255.1.13176 WP_000098255.1.13217 WP_000098255.1.13223 WP_000098255.1.13239 WP_000098255.1.13258 WP_000098255.1.13281 WP_000098255.1.13290 WP_000098255.1.13332 WP_000098255.1.13333 WP_000098255.1.13348 WP_000098255.1.13430 WP_000098255.1.13442 WP_000098255.1.13481 WP_000098255.1.13618 WP_000098255.1.13664 WP_000098255.1.13877 WP_000098255.1.13881 WP_000098255.1.13936 WP_000098255.1.13939 WP_000098255.1.13949 WP_000098255.1.14030 WP_000098255.1.14110 WP_000098255.1.1438 WP_000098255.1.14453 WP_000098255.1.14501 WP_000098255.1.14529 WP_000098255.1.14621 WP_000098255.1.1470 WP_000098255.1.14748 WP_000098255.1.14811 WP_000098255.1.14833 WP_000098255.1.14992 WP_000098255.1.1512 WP_000098255.1.15177 WP_000098255.1.15356 WP_000098255.1.15453 WP_000098255.1.15503 WP_000098255.1.15527 WP_000098255.1.1559 WP_000098255.1.15626 WP_000098255.1.15702 WP_000098255.1.15740 WP_000098255.1.15782 WP_000098255.1.1588 WP_000098255.1.16075 WP_000098255.1.16086 WP_000098255.1.1609 WP_000098255.1.16133 WP_000098255.1.16222 WP_000098255.1.16270 WP_000098255.1.16272 WP_000098255.1.16294 WP_000098255.1.1634 WP_000098255.1.16435 WP_000098255.1.16463 WP_000098255.1.16481 WP_000098255.1.16541 WP_000098255.1.16577 WP_000098255.1.16700 WP_000098255.1.16845 WP_000098255.1.17018 WP_000098255.1.17087 WP_000098255.1.17114 WP_000098255.1.17150 WP_000098255.1.17153 WP_000098255.1.17187 WP_000098255.1.17216 WP_000098255.1.1731 WP_000098255.1.17386 WP_000098255.1.17415 WP_000098255.1.17515 WP_000098255.1.17534 WP_000098255.1.1755 WP_000098255.1.17577 WP_000098255.1.1763 WP_000098255.1.17831 WP_000098255.1.17889 WP_000098255.1.17904 WP_000098255.1.17937 WP_000098255.1.17952 WP_000098255.1.18112 WP_000098255.1.18133 WP_000098255.1.18134 WP_000098255.1.18136 WP_000098255.1.18229 WP_000098255.1.18275 WP_000098255.1.18326 WP_000098255.1.18329 WP_000098255.1.1834 WP_000098255.1.18340 WP_000098255.1.18381 WP_000098255.1.18402 WP_000098255.1.1881 WP_000098255.1.18837 WP_000098255.1.18858 WP_000098255.1.18995 WP_000098255.1.19039 WP_000098255.1.191 WP_000098255.1.19140 WP_000098255.1.19150 WP_000098255.1.19277 WP_000098255.1.193 WP_000098255.1.19313 WP_000098255.1.19350 WP_000098255.1.19419 WP_000098255.1.19441 WP_000098255.1.1963 WP_000098255.1.19644 WP_000098255.1.19684 WP_000098255.1.19691 WP_000098255.1.19840 WP_000098255.1.19847 WP_000098255.1.19940 WP_000098255.1.19957 WP_000098255.1.19994 WP_000098255.1.2005 WP_000098255.1.20133 WP_000098255.1.20151 WP_000098255.1.20264 WP_000098255.1.20331 WP_000098255.1.20449 WP_000098255.1.20480 WP_000098255.1.20506 WP_000098255.1.20536 WP_000098255.1.20546 WP_000098255.1.20594 WP_000098255.1.2063 WP_000098255.1.20691 WP_000098255.1.20745 WP_000098255.1.20765 WP_000098255.1.20893 WP_000098255.1.20941 WP_000098255.1.20943 WP_000098255.1.20950 WP_000098255.1.20958 WP_000098255.1.20989 WP_000098255.1.21057 WP_000098255.1.21251 WP_000098255.1.2142 WP_000098255.1.21508 WP_000098255.1.21661 WP_000098255.1.21666 WP_000098255.1.21668 WP_000098255.1.21756 WP_000098255.1.21915 WP_000098255.1.21962 WP_000098255.1.22113 WP_000098255.1.2218 WP_000098255.1.22251 WP_000098255.1.22304 WP_000098255.1.22314 WP_000098255.1.22381 WP_000098255.1.22450 WP_000098255.1.22574 WP_000098255.1.22579 WP_000098255.1.22594 WP_000098255.1.22632 WP_000098255.1.22649 WP_000098255.1.22669 WP_000098255.1.22690 WP_000098255.1.22743 WP_000098255.1.22783 WP_000098255.1.22830 WP_000098255.1.22878 WP_000098255.1.22925 WP_000098255.1.2300 WP_000098255.1.23044 WP_000098255.1.23073 WP_000098255.1.23115 WP_000098255.1.23241 WP_000098255.1.23299 WP_000098255.1.23323 WP_000098255.1.23351 WP_000098255.1.23355 WP_000098255.1.23378 WP_000098255.1.23467 WP_000098255.1.23511 WP_000098255.1.2362 WP_000098255.1.23790 WP_000098255.1.23806 WP_000098255.1.23838 WP_000098255.1.23855 WP_000098255.1.2388 WP_000098255.1.23895 WP_000098255.1.23899 WP_000098255.1.23973 WP_000098255.1.23984 WP_000098255.1.24070 WP_000098255.1.24089 WP_000098255.1.24124 WP_000098255.1.2428 WP_000098255.1.24283 WP_000098255.1.24304 WP_000098255.1.24341 WP_000098255.1.24583 WP_000098255.1.24616 WP_000098255.1.24753 WP_000098255.1.24854 WP_000098255.1.24870 WP_000098255.1.24876 WP_000098255.1.24899 WP_000098255.1.24968 WP_000098255.1.25076 WP_000098255.1.25082 WP_000098255.1.25088 WP_000098255.1.25141 WP_000098255.1.25183 WP_000098255.1.25201 WP_000098255.1.25305 WP_000098255.1.2531 WP_000098255.1.25525 WP_000098255.1.25526 WP_000098255.1.25577 WP_000098255.1.25643 WP_000098255.1.25713 WP_000098255.1.25794 WP_000098255.1.25819 WP_000098255.1.25831 WP_000098255.1.25832 WP_000098255.1.25996 WP_000098255.1.26048 WP_000098255.1.26066 WP_000098255.1.26105 WP_000098255.1.26121 WP_000098255.1.26134 WP_000098255.1.26150 WP_000098255.1.26246 WP_000098255.1.26379 WP_000098255.1.26403 WP_000098255.1.26438 WP_000098255.1.26474 WP_000098255.1.26480 WP_000098255.1.26525 WP_000098255.1.26590 WP_000098255.1.26761 WP_000098255.1.26878 WP_000098255.1.26975 WP_000098255.1.26998 WP_000098255.1.27057 WP_000098255.1.27134 WP_000098255.1.27260 WP_000098255.1.27338 WP_000098255.1.27445 WP_000098255.1.27451 WP_000098255.1.27518 WP_000098255.1.27560 WP_000098255.1.27774 WP_000098255.1.27879 WP_000098255.1.27923 WP_000098255.1.28128 WP_000098255.1.28143 WP_000098255.1.28271 WP_000098255.1.28318 WP_000098255.1.28371 WP_000098255.1.28509 WP_000098255.1.28551 WP_000098255.1.28697 WP_000098255.1.28711 WP_000098255.1.28734 WP_000098255.1.28760 WP_000098255.1.28809 WP_000098255.1.28863 WP_000098255.1.28879 WP_000098255.1.28919 WP_000098255.1.28994 WP_000098255.1.29016 WP_000098255.1.29026 WP_000098255.1.291 WP_000098255.1.29100 WP_000098255.1.29126 WP_000098255.1.29239 WP_000098255.1.29404 WP_000098255.1.2945 WP_000098255.1.29564 WP_000098255.1.29597 WP_000098255.1.29618 WP_000098255.1.29746 WP_000098255.1.2978 WP_000098255.1.29818 WP_000098255.1.2995 WP_000098255.1.29976 WP_000098255.1.30 WP_000098255.1.30019 WP_000098255.1.30052 WP_000098255.1.30064 WP_000098255.1.30164 WP_000098255.1.30247 WP_000098255.1.30472 WP_000098255.1.30476 WP_000098255.1.30479 WP_000098255.1.30497 WP_000098255.1.30546 WP_000098255.1.30554 WP_000098255.1.30630 WP_000098255.1.30637 WP_000098255.1.30639 WP_000098255.1.30749 WP_000098255.1.30918 WP_000098255.1.30993 WP_000098255.1.30999 WP_000098255.1.31000 WP_000098255.1.31055 WP_000098255.1.31142 WP_000098255.1.31154 WP_000098255.1.312 WP_000098255.1.31211 WP_000098255.1.31252 WP_000098255.1.31379 WP_000098255.1.3140 WP_000098255.1.31401 WP_000098255.1.31407 WP_000098255.1.31421 WP_000098255.1.31575 WP_000098255.1.3169 WP_000098255.1.31715 WP_000098255.1.3181 WP_000098255.1.31833 WP_000098255.1.31839 WP_000098255.1.31898 WP_000098255.1.31956 WP_000098255.1.31978 WP_000098255.1.32063 WP_000098255.1.32089 WP_000098255.1.32093 WP_000098255.1.32121 WP_000098255.1.32143 WP_000098255.1.322 WP_000098255.1.32222 WP_000098255.1.32243 WP_000098255.1.3233 WP_000098255.1.32394 WP_000098255.1.32509 WP_000098255.1.32536 WP_000098255.1.32574 WP_000098255.1.32590 WP_000098255.1.32661 WP_000098255.1.32815 WP_000098255.1.32835 WP_000098255.1.32888 WP_000098255.1.32903 WP_000098255.1.32931 WP_000098255.1.3295 WP_000098255.1.32984 WP_000098255.1.33049 WP_000098255.1.33055 WP_000098255.1.33094 WP_000098255.1.33125 WP_000098255.1.33146 WP_000098255.1.33167 WP_000098255.1.33178 WP_000098255.1.33268 WP_000098255.1.33385 WP_000098255.1.334 WP_000098255.1.33422 WP_000098255.1.33424 WP_000098255.1.33476 WP_000098255.1.33526 WP_000098255.1.33565 WP_000098255.1.33631 WP_000098255.1.33648 WP_000098255.1.33736 WP_000098255.1.33799 WP_000098255.1.33879 WP_000098255.1.33888 WP_000098255.1.33948 WP_000098255.1.33981 WP_000098255.1.3401 WP_000098255.1.34124 WP_000098255.1.342 WP_000098255.1.34224 WP_000098255.1.34269 WP_000098255.1.34270 WP_000098255.1.34277 WP_000098255.1.34332 WP_000098255.1.34341 WP_000098255.1.34363 WP_000098255.1.34383 WP_000098255.1.34500 WP_000098255.1.34538 WP_000098255.1.34686 WP_000098255.1.34727 WP_000098255.1.34990 WP_000098255.1.34993 WP_000098255.1.3515 WP_000098255.1.35195 WP_000098255.1.35393 WP_000098255.1.3550 WP_000098255.1.35904 WP_000098255.1.36010 WP_000098255.1.36164 WP_000098255.1.3620 WP_000098255.1.36207 WP_000098255.1.36212 WP_000098255.1.36332 WP_000098255.1.36453 WP_000098255.1.36496 WP_000098255.1.36531 WP_000098255.1.36626 WP_000098255.1.36627 WP_000098255.1.36747 WP_000098255.1.36767 WP_000098255.1.37057 WP_000098255.1.37102 WP_000098255.1.37122 WP_000098255.1.37233 WP_000098255.1.37261 WP_000098255.1.37372 WP_000098255.1.37445 WP_000098255.1.37472 WP_000098255.1.37548 WP_000098255.1.37588 WP_000098255.1.3762 WP_000098255.1.37731 WP_000098255.1.37750 WP_000098255.1.37766 WP_000098255.1.37769 WP_000098255.1.37817 WP_000098255.1.37897 WP_000098255.1.3795 WP_000098255.1.37964 WP_000098255.1.38050 WP_000098255.1.38063 WP_000098255.1.38080 WP_000098255.1.38085 WP_000098255.1.38105 WP_000098255.1.38107 WP_000098255.1.3811 WP_000098255.1.3815 WP_000098255.1.38306 WP_000098255.1.38323 WP_000098255.1.38369 WP_000098255.1.38392 WP_000098255.1.38636 WP_000098255.1.38751 WP_000098255.1.38835 WP_000098255.1.38843 WP_000098255.1.389 WP_000098255.1.38958 WP_000098255.1.39164 WP_000098255.1.39180 WP_000098255.1.39268 WP_000098255.1.39310 WP_000098255.1.39356 WP_000098255.1.39365 WP_000098255.1.39367 WP_000098255.1.39415 WP_000098255.1.39430 WP_000098255.1.39564 WP_000098255.1.39601 WP_000098255.1.39646 WP_000098255.1.39820 WP_000098255.1.39829 WP_000098255.1.39938 WP_000098255.1.39961 WP_000098255.1.39966 WP_000098255.1.39970 WP_000098255.1.39992 WP_000098255.1.40013 WP_000098255.1.40016 WP_000098255.1.40113 WP_000098255.1.40192 WP_000098255.1.40212 WP_000098255.1.40234 WP_000098255.1.40298 WP_000098255.1.4030 WP_000098255.1.40317 WP_000098255.1.40389 WP_000098255.1.40445 WP_000098255.1.40548 WP_000098255.1.40549 WP_000098255.1.406 WP_000098255.1.40629 WP_000098255.1.40666 WP_000098255.1.40742 WP_000098255.1.40758 WP_000098255.1.40793 WP_000098255.1.40882 WP_000098255.1.40898 WP_000098255.1.40900 WP_000098255.1.40912 WP_000098255.1.40952 WP_000098255.1.40965 WP_000098255.1.4103 WP_000098255.1.41060 WP_000098255.1.41294 WP_000098255.1.41330 WP_000098255.1.41363 WP_000098255.1.41401 WP_000098255.1.41478 WP_000098255.1.41484 WP_000098255.1.41488 WP_000098255.1.41536 WP_000098255.1.41556 WP_000098255.1.41621 WP_000098255.1.41734 WP_000098255.1.41782 WP_000098255.1.41813 WP_000098255.1.41849 WP_000098255.1.41900 WP_000098255.1.42022 WP_000098255.1.42033 WP_000098255.1.42036 WP_000098255.1.42113 WP_000098255.1.4213 WP_000098255.1.42209 WP_000098255.1.42376 WP_000098255.1.42447 WP_000098255.1.4250 WP_000098255.1.42513 WP_000098255.1.42547 WP_000098255.1.42594 WP_000098255.1.4261 WP_000098255.1.42632 WP_000098255.1.42770 WP_000098255.1.4282 WP_000098255.1.42863 WP_000098255.1.42879 WP_000098255.1.4290 WP_000098255.1.42936 WP_000098255.1.42975 WP_000098255.1.43013 WP_000098255.1.43035 WP_000098255.1.4306 WP_000098255.1.43079 WP_000098255.1.43121 WP_000098255.1.4313 WP_000098255.1.43140 WP_000098255.1.43196 WP_000098255.1.43270 WP_000098255.1.43384 WP_000098255.1.43444 WP_000098255.1.43448 WP_000098255.1.43469 WP_000098255.1.43489 WP_000098255.1.43536 WP_000098255.1.43604 WP_000098255.1.43754 WP_000098255.1.43798 WP_000098255.1.43816 WP_000098255.1.43837 WP_000098255.1.43898 WP_000098255.1.43911 WP_000098255.1.43939 WP_000098255.1.43989 WP_000098255.1.44115 WP_000098255.1.44125 WP_000098255.1.44162 WP_000098255.1.44165 WP_000098255.1.44166 WP_000098255.1.44203 WP_000098255.1.44324 WP_000098255.1.44365 WP_000098255.1.44389 WP_000098255.1.44458 WP_000098255.1.44488 WP_000098255.1.44558 WP_000098255.1.44561 WP_000098255.1.44610 WP_000098255.1.44733 WP_000098255.1.44821 WP_000098255.1.44841 WP_000098255.1.44849 WP_000098255.1.44906 WP_000098255.1.44954 WP_000098255.1.44960 WP_000098255.1.44970 WP_000098255.1.44980 WP_000098255.1.45020 WP_000098255.1.45028 WP_000098255.1.45076 WP_000098255.1.45116 WP_000098255.1.45153 WP_000098255.1.45195 WP_000098255.1.45293 WP_000098255.1.45329 WP_000098255.1.45404 WP_000098255.1.45440 WP_000098255.1.4549 WP_000098255.1.45565 WP_000098255.1.45575 WP_000098255.1.45664 WP_000098255.1.45707 WP_000098255.1.45741 WP_000098255.1.45841 WP_000098255.1.45901 WP_000098255.1.45933 WP_000098255.1.45941 WP_000098255.1.46039 WP_000098255.1.46115 WP_000098255.1.46186 WP_000098255.1.4619 WP_000098255.1.46282 WP_000098255.1.46283 WP_000098255.1.46369 WP_000098255.1.46414 WP_000098255.1.46451 WP_000098255.1.46503 WP_000098255.1.46582 WP_000098255.1.46597 WP_000098255.1.46611 WP_000098255.1.46626 WP_000098255.1.46802 WP_000098255.1.46810 WP_000098255.1.46832 WP_000098255.1.46913 WP_000098255.1.46932 WP_000098255.1.47048 WP_000098255.1.47063 WP_000098255.1.4708 WP_000098255.1.47140 WP_000098255.1.47156 WP_000098255.1.47197 WP_000098255.1.47224 WP_000098255.1.4723 WP_000098255.1.47411 WP_000098255.1.47414 WP_000098255.1.47496 WP_000098255.1.47634 WP_000098255.1.47654 WP_000098255.1.47673 WP_000098255.1.47734 WP_000098255.1.47740 WP_000098255.1.47765 WP_000098255.1.47784 WP_000098255.1.47791 WP_000098255.1.47827 WP_000098255.1.47884 WP_000098255.1.47954 WP_000098255.1.47994 WP_000098255.1.48048 WP_000098255.1.48065 WP_000098255.1.4812 WP_000098255.1.48176 WP_000098255.1.48194 WP_000098255.1.48203 WP_000098255.1.48226 WP_000098255.1.48258 WP_000098255.1.48290 WP_000098255.1.48353 WP_000098255.1.48522 WP_000098255.1.48697 WP_000098255.1.4871 WP_000098255.1.48712 WP_000098255.1.48792 WP_000098255.1.48806 WP_000098255.1.48860 WP_000098255.1.48953 WP_000098255.1.48974 WP_000098255.1.49009 WP_000098255.1.49236 WP_000098255.1.49275 WP_000098255.1.4931 WP_000098255.1.49332 WP_000098255.1.49401 WP_000098255.1.49464 WP_000098255.1.49496 WP_000098255.1.49531 WP_000098255.1.49537 WP_000098255.1.49567 WP_000098255.1.49621 WP_000098255.1.49645 WP_000098255.1.49655 WP_000098255.1.49661 WP_000098255.1.497 WP_000098255.1.49733 WP_000098255.1.49768 WP_000098255.1.49771 WP_000098255.1.49900 WP_000098255.1.50006 WP_000098255.1.50008 WP_000098255.1.5003 WP_000098255.1.50078 WP_000098255.1.50110 WP_000098255.1.5017 WP_000098255.1.50345 WP_000098255.1.50358 WP_000098255.1.5037 WP_000098255.1.50380 WP_000098255.1.50549 WP_000098255.1.5056 WP_000098255.1.50564 WP_000098255.1.50762 WP_000098255.1.50986 WP_000098255.1.51027 WP_000098255.1.51042 WP_000098255.1.5106 WP_000098255.1.51154 WP_000098255.1.51171 WP_000098255.1.51325 WP_000098255.1.51425 WP_000098255.1.51505 WP_000098255.1.51552 WP_000098255.1.51587 WP_000098255.1.51607 WP_000098255.1.51643 WP_000098255.1.51693 WP_000098255.1.51784 WP_000098255.1.51834 WP_000098255.1.51873 WP_000098255.1.52002 WP_000098255.1.52020 WP_000098255.1.52039 WP_000098255.1.52135 WP_000098255.1.5217 WP_000098255.1.52211 WP_000098255.1.52214 WP_000098255.1.52305 WP_000098255.1.52333 WP_000098255.1.52399 WP_000098255.1.52492 WP_000098255.1.52496 WP_000098255.1.52543 WP_000098255.1.52544 WP_000098255.1.52558 WP_000098255.1.5265 WP_000098255.1.5272 WP_000098255.1.52774 WP_000098255.1.52844 WP_000098255.1.52853 WP_000098255.1.52883 WP_000098255.1.52895 WP_000098255.1.52933 WP_000098255.1.52945 WP_000098255.1.53012 WP_000098255.1.53020 WP_000098255.1.53084 WP_000098255.1.53110 WP_000098255.1.53181 WP_000098255.1.53211 WP_000098255.1.53244 WP_000098255.1.53252 WP_000098255.1.53270 WP_000098255.1.53327 WP_000098255.1.53377 WP_000098255.1.53545 WP_000098255.1.53645 WP_000098255.1.53769 WP_000098255.1.53884 WP_000098255.1.53931 WP_000098255.1.53972 WP_000098255.1.54002 WP_000098255.1.54024 WP_000098255.1.54028 WP_000098255.1.54213 WP_000098255.1.54328 WP_000098255.1.54329 WP_000098255.1.54344 WP_000098255.1.5441 WP_000098255.1.54454 WP_000098255.1.54463 WP_000098255.1.54605 WP_000098255.1.5461 WP_000098255.1.54620 WP_000098255.1.5470 WP_000098255.1.5486 WP_000098255.1.54883 WP_000098255.1.54981 WP_000098255.1.55005 WP_000098255.1.55112 WP_000098255.1.55123 WP_000098255.1.55218 WP_000098255.1.55286 WP_000098255.1.55359 WP_000098255.1.55374 WP_000098255.1.55425 WP_000098255.1.55492 WP_000098255.1.55551 WP_000098255.1.55556 WP_000098255.1.55608 WP_000098255.1.55676 WP_000098255.1.55720 WP_000098255.1.55791 WP_000098255.1.55820 WP_000098255.1.55825 WP_000098255.1.55838 WP_000098255.1.55868 WP_000098255.1.55892 WP_000098255.1.55897 WP_000098255.1.56072 WP_000098255.1.5614 WP_000098255.1.56151 WP_000098255.1.56164 WP_000098255.1.5639 WP_000098255.1.56392 WP_000098255.1.56436 WP_000098255.1.56481 WP_000098255.1.56489 WP_000098255.1.56491 WP_000098255.1.56501 WP_000098255.1.56554 WP_000098255.1.56571 WP_000098255.1.56789 WP_000098255.1.56830 WP_000098255.1.56932 WP_000098255.1.56934 WP_000098255.1.57032 WP_000098255.1.57068 WP_000098255.1.57071 WP_000098255.1.57180 WP_000098255.1.57181 WP_000098255.1.57197 WP_000098255.1.57280 WP_000098255.1.57401 WP_000098255.1.57403 WP_000098255.1.57410 WP_000098255.1.57414 WP_000098255.1.57453 WP_000098255.1.57466 WP_000098255.1.57610 WP_000098255.1.5764 WP_000098255.1.57646 WP_000098255.1.57719 WP_000098255.1.57836 WP_000098255.1.5786 WP_000098255.1.57904 WP_000098255.1.58048 WP_000098255.1.58057 WP_000098255.1.58080 WP_000098255.1.5810 WP_000098255.1.58169 WP_000098255.1.58232 WP_000098255.1.58238 WP_000098255.1.58316 WP_000098255.1.58340 WP_000098255.1.58384 WP_000098255.1.584 WP_000098255.1.58401 WP_000098255.1.5842 WP_000098255.1.58420 WP_000098255.1.58423 WP_000098255.1.58429 WP_000098255.1.58440 WP_000098255.1.5852 WP_000098255.1.58707 WP_000098255.1.58723 WP_000098255.1.58837 WP_000098255.1.58940 WP_000098255.1.58951 WP_000098255.1.59026 WP_000098255.1.59038 WP_000098255.1.59047 WP_000098255.1.59306 WP_000098255.1.59359 WP_000098255.1.59374 WP_000098255.1.59470 WP_000098255.1.59491 WP_000098255.1.59513 WP_000098255.1.59533 WP_000098255.1.59553 WP_000098255.1.59590 WP_000098255.1.59615 WP_000098255.1.59679 WP_000098255.1.59733 WP_000098255.1.59838 WP_000098255.1.59858 WP_000098255.1.59905 WP_000098255.1.59931 WP_000098255.1.59959 WP_000098255.1.59998 WP_000098255.1.6002 WP_000098255.1.60023 WP_000098255.1.60042 WP_000098255.1.60043 WP_000098255.1.60067 WP_000098255.1.60117 WP_000098255.1.6013 WP_000098255.1.60304 WP_000098255.1.60343 WP_000098255.1.60374 WP_000098255.1.60461 WP_000098255.1.60477 WP_000098255.1.60505 WP_000098255.1.60576 WP_000098255.1.6061 WP_000098255.1.60613 WP_000098255.1.60647 WP_000098255.1.6066 WP_000098255.1.60717 WP_000098255.1.60744 WP_000098255.1.60761 WP_000098255.1.60872 WP_000098255.1.60901 WP_000098255.1.60935 WP_000098255.1.61039 WP_000098255.1.6106 WP_000098255.1.61097 WP_000098255.1.61099 WP_000098255.1.61102 WP_000098255.1.61186 WP_000098255.1.61253 WP_000098255.1.61505 WP_000098255.1.61517 WP_000098255.1.61623 WP_000098255.1.61663 WP_000098255.1.61770 WP_000098255.1.61772 WP_000098255.1.618 WP_000098255.1.61822 WP_000098255.1.61858 WP_000098255.1.61874 WP_000098255.1.61949 WP_000098255.1.62135 WP_000098255.1.62157 WP_000098255.1.62182 WP_000098255.1.62207 WP_000098255.1.62480 WP_000098255.1.6261 WP_000098255.1.62642 WP_000098255.1.62668 WP_000098255.1.62675 WP_000098255.1.62735 WP_000098255.1.62787 WP_000098255.1.62812 WP_000098255.1.62843 WP_000098255.1.62888 WP_000098255.1.62919 WP_000098255.1.62989 WP_000098255.1.63167 WP_000098255.1.6331 WP_000098255.1.6337 WP_000098255.1.63445 WP_000098255.1.63453 WP_000098255.1.63478 WP_000098255.1.6348 WP_000098255.1.63563 WP_000098255.1.63586 WP_000098255.1.63615 WP_000098255.1.6364 WP_000098255.1.63810 WP_000098255.1.63872 WP_000098255.1.63957 WP_000098255.1.64040 WP_000098255.1.64080 WP_000098255.1.64086 WP_000098255.1.64161 WP_000098255.1.64285 WP_000098255.1.6431 WP_000098255.1.64353 WP_000098255.1.64371 WP_000098255.1.64448 WP_000098255.1.6445 WP_000098255.1.64621 WP_000098255.1.647 WP_000098255.1.64749 WP_000098255.1.64789 WP_000098255.1.64946 WP_000098255.1.65035 WP_000098255.1.65084 WP_000098255.1.6511 WP_000098255.1.65118 WP_000098255.1.65194 WP_000098255.1.65256 WP_000098255.1.65271 WP_000098255.1.65353 WP_000098255.1.65372 WP_000098255.1.65415 WP_000098255.1.65546 WP_000098255.1.6563 WP_000098255.1.6587 WP_000098255.1.65875 WP_000098255.1.65898 WP_000098255.1.65912 WP_000098255.1.65961 WP_000098255.1.65963 WP_000098255.1.65978 WP_000098255.1.65988 WP_000098255.1.66033 WP_000098255.1.66050 WP_000098255.1.66100 WP_000098255.1.66104 WP_000098255.1.66105 WP_000098255.1.66251 WP_000098255.1.66327 WP_000098255.1.6635 WP_000098255.1.66387 WP_000098255.1.66389 WP_000098255.1.66395 WP_000098255.1.66501 WP_000098255.1.66531 WP_000098255.1.6654 WP_000098255.1.66559 WP_000098255.1.66566 WP_000098255.1.66624 WP_000098255.1.66700 WP_000098255.1.66719 WP_000098255.1.66796 WP_000098255.1.66873 WP_000098255.1.66922 WP_000098255.1.67021 WP_000098255.1.67022 WP_000098255.1.67073 WP_000098255.1.67136 WP_000098255.1.67137 WP_000098255.1.67150 WP_000098255.1.67158 WP_000098255.1.67210 WP_000098255.1.67214 WP_000098255.1.67272 WP_000098255.1.67293 WP_000098255.1.67446 WP_000098255.1.67451 WP_000098255.1.67533 WP_000098255.1.67538 WP_000098255.1.67676 WP_000098255.1.6769 WP_000098255.1.67726 WP_000098255.1.67732 WP_000098255.1.67753 WP_000098255.1.67775 WP_000098255.1.67780 WP_000098255.1.67786 WP_000098255.1.67787 WP_000098255.1.67853 WP_000098255.1.67861 WP_000098255.1.67971 WP_000098255.1.67990 WP_000098255.1.68012 WP_000098255.1.68096 WP_000098255.1.68170 WP_000098255.1.68215 WP_000098255.1.68396 WP_000098255.1.68411 WP_000098255.1.68493 WP_000098255.1.68523 WP_000098255.1.68697 WP_000098255.1.68711 WP_000098255.1.6877 WP_000098255.1.68797 WP_000098255.1.6880 WP_000098255.1.68865 WP_000098255.1.6887 WP_000098255.1.68915 WP_000098255.1.68936 WP_000098255.1.69033 WP_000098255.1.69054 WP_000098255.1.69127 WP_000098255.1.69303 WP_000098255.1.69305 WP_000098255.1.69350 WP_000098255.1.69351 WP_000098255.1.69473 WP_000098255.1.69655 WP_000098255.1.69780 WP_000098255.1.69803 WP_000098255.1.69810 WP_000098255.1.69818 WP_000098255.1.69896 WP_000098255.1.70123 WP_000098255.1.70125 WP_000098255.1.70200 WP_000098255.1.70407 WP_000098255.1.70517 WP_000098255.1.70539 WP_000098255.1.70576 WP_000098255.1.70705 WP_000098255.1.70723 WP_000098255.1.70787 WP_000098255.1.70794 WP_000098255.1.71003 WP_000098255.1.71024 WP_000098255.1.71099 WP_000098255.1.71159 WP_000098255.1.71199 WP_000098255.1.71205 WP_000098255.1.71225 WP_000098255.1.71226 WP_000098255.1.71229 WP_000098255.1.71269 WP_000098255.1.71312 WP_000098255.1.71315 WP_000098255.1.71323 WP_000098255.1.71397 WP_000098255.1.71409 WP_000098255.1.71423 WP_000098255.1.71448 WP_000098255.1.71480 WP_000098255.1.71522 WP_000098255.1.71695 WP_000098255.1.71783 WP_000098255.1.71837 WP_000098255.1.71840 WP_000098255.1.71938 WP_000098255.1.71940 WP_000098255.1.71944 WP_000098255.1.71975 WP_000098255.1.71993 WP_000098255.1.72016 WP_000098255.1.72033 WP_000098255.1.7205 WP_000098255.1.72157 WP_000098255.1.72180 WP_000098255.1.72184 WP_000098255.1.72237 WP_000098255.1.72322 WP_000098255.1.72337 WP_000098255.1.72397 WP_000098255.1.72427 WP_000098255.1.72537 WP_000098255.1.72606 WP_000098255.1.72614 WP_000098255.1.72641 WP_000098255.1.72694 WP_000098255.1.72747 WP_000098255.1.7291 WP_000098255.1.72910 WP_000098255.1.72913 WP_000098255.1.72947 WP_000098255.1.7307 WP_000098255.1.73085 WP_000098255.1.73126 WP_000098255.1.73129 WP_000098255.1.73217 WP_000098255.1.73230 WP_000098255.1.73243 WP_000098255.1.73292 WP_000098255.1.73295 WP_000098255.1.73343 WP_000098255.1.73385 WP_000098255.1.73524 WP_000098255.1.73626 WP_000098255.1.73785 WP_000098255.1.73801 WP_000098255.1.73835 WP_000098255.1.73843 WP_000098255.1.73844 WP_000098255.1.73859 WP_000098255.1.7392 WP_000098255.1.73934 WP_000098255.1.73942 WP_000098255.1.73968 WP_000098255.1.74123 WP_000098255.1.74184 WP_000098255.1.74251 WP_000098255.1.7429 WP_000098255.1.74309 WP_000098255.1.74445 WP_000098255.1.7446 WP_000098255.1.74520 WP_000098255.1.74521 WP_000098255.1.74528 WP_000098255.1.74536 WP_000098255.1.74557 WP_000098255.1.7461 WP_000098255.1.74713 WP_000098255.1.7475 WP_000098255.1.74828 WP_000098255.1.74904 WP_000098255.1.75030 WP_000098255.1.75139 WP_000098255.1.75149 WP_000098255.1.75164 WP_000098255.1.75248 WP_000098255.1.7536 WP_000098255.1.75382 WP_000098255.1.7539 WP_000098255.1.75428 WP_000098255.1.75491 WP_000098255.1.75507 WP_000098255.1.75536 WP_000098255.1.75577 WP_000098255.1.75612 WP_000098255.1.75679 WP_000098255.1.75687 WP_000098255.1.75694 WP_000098255.1.75767 WP_000098255.1.7583 WP_000098255.1.75853 WP_000098255.1.75922 WP_000098255.1.7597 WP_000098255.1.75983 WP_000098255.1.75989 WP_000098255.1.75995 WP_000098255.1.76039 WP_000098255.1.76054 WP_000098255.1.7608 WP_000098255.1.76152 WP_000098255.1.76184 WP_000098255.1.76189 WP_000098255.1.76211 WP_000098255.1.76407 WP_000098255.1.76446 WP_000098255.1.76448 WP_000098255.1.76477 WP_000098255.1.76697 WP_000098255.1.76707 WP_000098255.1.76712 WP_000098255.1.76827 WP_000098255.1.77099 WP_000098255.1.77128 WP_000098255.1.77173 WP_000098255.1.77175 WP_000098255.1.77214 WP_000098255.1.77239 WP_000098255.1.77275 WP_000098255.1.77291 WP_000098255.1.77358 WP_000098255.1.77392 WP_000098255.1.77471 WP_000098255.1.77595 WP_000098255.1.77644 WP_000098255.1.77648 WP_000098255.1.77707 WP_000098255.1.77760 WP_000098255.1.77961 WP_000098255.1.77979 WP_000098255.1.7799 WP_000098255.1.78000 WP_000098255.1.78063 WP_000098255.1.78101 WP_000098255.1.78321 WP_000098255.1.784 WP_000098255.1.78462 WP_000098255.1.7847 WP_000098255.1.78527 WP_000098255.1.7855 WP_000098255.1.78581 WP_000098255.1.78583 WP_000098255.1.78593 WP_000098255.1.78611 WP_000098255.1.78612 WP_000098255.1.79004 WP_000098255.1.79086 WP_000098255.1.79172 WP_000098255.1.79246 WP_000098255.1.7940 WP_000098255.1.79478 WP_000098255.1.79505 WP_000098255.1.79528 WP_000098255.1.79558 WP_000098255.1.79563 WP_000098255.1.79576 WP_000098255.1.79685 WP_000098255.1.79715 WP_000098255.1.79764 WP_000098255.1.7985 WP_000098255.1.79866 WP_000098255.1.7987 WP_000098255.1.79931 WP_000098255.1.79965 WP_000098255.1.79984 WP_000098255.1.80050 WP_000098255.1.80060 WP_000098255.1.80136 WP_000098255.1.80183 WP_000098255.1.80309 WP_000098255.1.80320 WP_000098255.1.80330 WP_000098255.1.80402 WP_000098255.1.80428 WP_000098255.1.80440 WP_000098255.1.80524 WP_000098255.1.8057 WP_000098255.1.80578 WP_000098255.1.80606 WP_000098255.1.80612 WP_000098255.1.80666 WP_000098255.1.80768 WP_000098255.1.80805 WP_000098255.1.80884 WP_000098255.1.81034 WP_000098255.1.81054 WP_000098255.1.81070 WP_000098255.1.81127 WP_000098255.1.81160 WP_000098255.1.81219 WP_000098255.1.81273 WP_000098255.1.81286 WP_000098255.1.81313 WP_000098255.1.81420 WP_000098255.1.81442 WP_000098255.1.81514 WP_000098255.1.81577 WP_000098255.1.81589 WP_000098255.1.81618 WP_000098255.1.81715 WP_000098255.1.81754 WP_000098255.1.81806 WP_000098255.1.81821 WP_000098255.1.81873 WP_000098255.1.81934 WP_000098255.1.81975 WP_000098255.1.82010 WP_000098255.1.82057 WP_000098255.1.82275 WP_000098255.1.82296 WP_000098255.1.8235 WP_000098255.1.82594 WP_000098255.1.82629 WP_000098255.1.82647 WP_000098255.1.82661 WP_000098255.1.8268 WP_000098255.1.82691 WP_000098255.1.82711 WP_000098255.1.82715 WP_000098255.1.82754 WP_000098255.1.82797 WP_000098255.1.82820 WP_000098255.1.83020 WP_000098255.1.8308 WP_000098255.1.83093 WP_000098255.1.83099 WP_000098255.1.831 WP_000098255.1.83140 WP_000098255.1.83144 WP_000098255.1.83205 WP_000098255.1.83224 WP_000098255.1.83537 WP_000098255.1.83544 WP_000098255.1.83706 WP_000098255.1.83712 WP_000098255.1.83735 WP_000098255.1.83781 WP_000098255.1.83941 WP_000098255.1.8411 WP_000098255.1.84219 WP_000098255.1.84264 WP_000098255.1.84312 WP_000098255.1.84331 WP_000098255.1.84339 WP_000098255.1.84405 WP_000098255.1.84410 WP_000098255.1.8444 WP_000098255.1.84467 WP_000098255.1.84482 WP_000098255.1.84584 WP_000098255.1.84635 WP_000098255.1.84657 WP_000098255.1.84738 WP_000098255.1.84740 WP_000098255.1.8477 WP_000098255.1.84797 WP_000098255.1.84948 WP_000098255.1.84966 WP_000098255.1.84977 WP_000098255.1.84989 WP_000098255.1.84994 WP_000098255.1.85002 WP_000098255.1.85052 WP_000098255.1.85253 WP_000098255.1.85310 WP_000098255.1.85621 WP_000098255.1.85722 WP_000098255.1.85772 WP_000098255.1.85773 WP_000098255.1.85806 WP_000098255.1.85948 WP_000098255.1.86001 WP_000098255.1.86016 WP_000098255.1.86105 WP_000098255.1.86161 WP_000098255.1.86171 WP_000098255.1.8621 WP_000098255.1.86225 WP_000098255.1.86228 WP_000098255.1.86255 WP_000098255.1.86276 WP_000098255.1.86340 WP_000098255.1.86412 WP_000098255.1.86461 WP_000098255.1.86475 WP_000098255.1.86574 WP_000098255.1.86691 WP_000098255.1.86848 WP_000098255.1.86959 WP_000098255.1.86994 WP_000098255.1.87076 WP_000098255.1.87247 WP_000098255.1.87254 WP_000098255.1.87382 WP_000098255.1.87389 WP_000098255.1.87563 WP_000098255.1.87574 WP_000098255.1.87610 WP_000098255.1.87616 WP_000098255.1.87655 WP_000098255.1.87721 WP_000098255.1.87919 WP_000098255.1.88110 WP_000098255.1.88197 WP_000098255.1.88263 WP_000098255.1.88301 WP_000098255.1.8843 WP_000098255.1.88434 WP_000098255.1.88528 WP_000098255.1.88607 WP_000098255.1.88667 WP_000098255.1.88729 WP_000098255.1.88757 WP_000098255.1.88803 WP_000098255.1.88834 WP_000098255.1.88891 WP_000098255.1.88961 WP_000098255.1.89099 WP_000098255.1.89255 WP_000098255.1.89322 WP_000098255.1.89385 WP_000098255.1.89405 WP_000098255.1.89458 WP_000098255.1.89468 WP_000098255.1.89569 WP_000098255.1.89700 WP_000098255.1.89781 WP_000098255.1.89852 WP_000098255.1.89923 WP_000098255.1.89988 WP_000098255.1.90017 WP_000098255.1.90078 WP_000098255.1.90139 WP_000098255.1.90219 WP_000098255.1.90257 WP_000098255.1.90342 WP_000098255.1.90349 WP_000098255.1.90358 WP_000098255.1.90449 WP_000098255.1.90520 WP_000098255.1.90690 WP_000098255.1.90703 WP_000098255.1.90799 WP_000098255.1.90837 WP_000098255.1.90848 WP_000098255.1.90865 WP_000098255.1.90951 WP_000098255.1.90967 WP_000098255.1.9098 WP_000098255.1.90997 WP_000098255.1.91 WP_000098255.1.91018 WP_000098255.1.91072 WP_000098255.1.91088 WP_000098255.1.91121 WP_000098255.1.91153 WP_000098255.1.91170 WP_000098255.1.91288 WP_000098255.1.91340 WP_000098255.1.91356 WP_000098255.1.91384 WP_000098255.1.91462 WP_000098255.1.915 WP_000098255.1.91516 WP_000098255.1.91548 WP_000098255.1.91551 WP_000098255.1.91651 WP_000098255.1.9168 WP_000098255.1.9169 WP_000098255.1.91739 WP_000098255.1.91801 WP_000098255.1.91871 WP_000098255.1.91994 WP_000098255.1.9215 WP_000098255.1.92161 WP_000098255.1.92304 WP_000098255.1.92323 WP_000098255.1.92615 WP_000098255.1.9264 WP_000098255.1.92708 WP_000098255.1.92819 WP_000098255.1.92845 WP_000098255.1.92865 WP_000098255.1.92943 WP_000098255.1.92989 WP_000098255.1.93019 WP_000098255.1.93027 WP_000098255.1.93054 WP_000098255.1.93069 WP_000098255.1.93112 WP_000098255.1.9327 WP_000098255.1.93276 WP_000098255.1.93427 WP_000098255.1.93428 WP_000098255.1.93601 WP_000098255.1.93621 WP_000098255.1.93630 WP_000098255.1.93652 WP_000098255.1.93670 WP_000098255.1.93673 WP_000098255.1.93695 WP_000098255.1.93755 WP_000098255.1.93821 WP_000098255.1.94025 WP_000098255.1.94187 WP_000098255.1.94213 WP_000098255.1.9426 WP_000098255.1.94271 WP_000098255.1.94343 WP_000098255.1.94388 WP_000098255.1.94445 WP_000098255.1.94544 WP_000098255.1.9457 WP_000098255.1.94626 WP_000098255.1.94676 WP_000098255.1.94695 WP_000098255.1.94738 WP_000098255.1.94764 WP_000098255.1.94790 WP_000098255.1.948 WP_000098255.1.9489 WP_000098255.1.94898 WP_000098255.1.94938 WP_000098255.1.94949 WP_000098255.1.94991 WP_000098255.1.94993 WP_000098255.1.95011 WP_000098255.1.95035 WP_000098255.1.95129 WP_000098255.1.95275 WP_000098255.1.95595 WP_000098255.1.95634 WP_000098255.1.95827 WP_000098255.1.95834 WP_000098255.1.95931 WP_000098255.1.9616 WP_000098255.1.96215 WP_000098255.1.96281 WP_000098255.1.96299 WP_000098255.1.96425 WP_000098255.1.96450 WP_000098255.1.96479 WP_000098255.1.96480 WP_000098255.1.96725 WP_000098255.1.96796 WP_000098255.1.96984 WP_000098255.1.97123 WP_000098255.1.97193 WP_000098255.1.9729 WP_000098255.1.97351 WP_000098255.1.9740 WP_000098255.1.97402 WP_000098255.1.97418 WP_000098255.1.97513 WP_000098255.1.97560 WP_000098255.1.97632 WP_000098255.1.97667 WP_000098255.1.9770 WP_000098255.1.97789 WP_000098255.1.97825 WP_000098255.1.97871 WP_000098255.1.97982 WP_000098255.1.97996 WP_000098255.1.98012 WP_000098255.1.98046 WP_000098255.1.98083 WP_000098255.1.981 WP_000098255.1.98155 WP_000098255.1.98176 WP_000098255.1.98187 WP_000098255.1.98202 WP_000098255.1.98205 WP_000098255.1.98220 WP_000098255.1.98235 WP_000098255.1.98241 WP_000098255.1.98279 WP_000098255.1.98294 WP_000098255.1.98312 WP_000098255.1.98355 WP_000098255.1.98384 WP_000098255.1.98404 WP_000098255.1.98424 WP_000098255.1.98442 WP_000098255.1.98477 WP_000098255.1.98543 WP_000098255.1.98569 WP_000098255.1.98578 WP_000098255.1.9864 WP_000098255.1.98776 WP_000098255.1.9883 WP_000098255.1.98920 WP_000098255.1.99101 WP_000098255.1.99182 WP_000098255.1.99234 WP_000098255.1.99265 WP_000098255.1.99319 WP_000098255.1.99400 WP_000098255.1.99487 WP_000098255.1.99501 WP_000098255.1.99602 WP_000098255.1.99603 WP_000098255.1.99692 WP_000098255.1.99986 gi|16130694|ref|NP_417267.1| gi|386615509|ref|YP_006135175.1| 1ec7A gi|291284116|ref|YP_003500934.1| gi|388478803|ref|YP_490995.1| gi|254794729|ref|YP_003079566.1| gi|387613409|ref|YP_006116525.1| gi|387622470|ref|YP_006130098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]