SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 386656.YPDSF_4023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  386656.YPDSF_4023
Domain Number - Region: 55-115
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000455
Family Retroviral integrase, catalytic domain 0.087
Further Details:      
 
Domain Number - Region: 5-40
Classification Level Classification E-value
Superfamily KA1-like 0.00458
Family Ssp2 C-terminal domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 386656.YPDSF_4023
Sequence length 126
Comment (Yersinia pestis Pestoides F)
Sequence
MVERYPRDGFFKVFQILRRWGYVWNHKRVHRIYCLLKLNIRRKGKQRLPARTPSPLAVPE
RLNLSGAVDFMHDALICVDDYNREKLAIEIDLNLPTQHVIRVLDRIVVNRGYPVMGFEVQ
WDENVR
Download sequence
Identical sequences A0A0E1NLA0 A0A0M1V1T7 E8PSI7 O68712
gi|162417818|ref|YP_001604515.1| gi|294496867|ref|YP_003560564.1| 349746.YpAngola_B0089 360102.YPA_CD0060 386656.YPDSF_4023 502801.YPTS_4239 gi|384124380|ref|YP_005506987.1| gi|108793702|ref|YP_636858.1| gi|108793702|ref|YP_636858.1|NC_008122 gi|145597186|ref|YP_001154650.1|NC_009377 gi|162417818|ref|YP_001604515.1|NC_010157 gi|186897528|ref|YP_001874639.1|NC_010635 gi|294496867|ref|YP_003560564.1|NC_014017 gi|31795312|ref|NP_857770.1|NC_004836 gi|322836507|ref|YP_004210003.1|NC_015056 gi|384120584|ref|YP_005503205.1|NC_017153 gi|384124380|ref|YP_005506987.1|NC_017157 gi|384412684|ref|YP_005622048.1|NC_017263 gi|384412684|ref|YP_005622048.1| gi|186897528|ref|YP_001874639.1| gi|145597186|ref|YP_001154650.1| gi|384120584|ref|YP_005503205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]