SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 387092.NIS_0310 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  387092.NIS_0310
Domain Number 1 Region: 436-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.96e-16
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 387092.NIS_0310
Sequence length 545
Comment (Nitratiruptor SB155-2)
Sequence
MISKKDLTGDIFGGITAAIVAIPLALAFGLQSGLGAIAGLYGAIALGIFASLFGGTKTQI
SGPTGPMTVVTAGVVITITEYYGSLDAAMGAILLTFVLAGIIQILMGVVGIGKYIRYVPY
PVVSGFMSGIGVIIIILQIFPFFGLESPKKILDILHSLHTIPEKINLQAMLLSLTTIAMI
YLFPKVTKKIPPTLVALVVLTIASTILGLNVPIIGHIPEGLPEIRTEIFSSFDFDIVTII
LVPAITLAALGAIDSLLTSLVADNLTKTQHDSNKELVGQGIGNAVAGLIGGIPGAGATMR
TVVNIKAGGRTQLSGVIHGVVLLIILLGAGEYAKLIPIPVLAGILITVGIGIIDYKGLKH
IMHVPKADAAIMIIVLFVTVFVDLLQAVAVGMILAALLFMKNMSDLAESKSFSSLLEDLY
HSKVLPDEKEIIEKFGKQVYIQHFEGPIFFGFTSYFKQLIQKLPDVKVVIFRMENVPFID
QSGLYAIEDALLSLQDKGIKVIFTGLQEQPKDLLTKVKLIPSLVKEDDIYENFGEAVKAV
STYLK
Download sequence
Identical sequences A6Q1R5
gi|152990059|ref|YP_001355781.1| WP_012081687.1.54627 387092.NIS_0310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]