SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 387093.SUN_0008 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  387093.SUN_0008
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.67e-34
Family Sfri0576-like 0.0000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 387093.SUN_0008
Sequence length 128
Comment (Sulfurovum NBC37-1)
Sequence
MAATIKEHGISVAIKRSKKRLFIELAMIGKLTHEDYKVFVPMIDKALKEAKGLEVDLLVD
MRKFKGWEMLAAWDDFKFGIKHRNKFDKMAIVGNKKWEEQSTAMMSHMMKGKSKFFLKRG
EALTWLMK
Download sequence
Identical sequences A6Q671
gi|152991605|ref|YP_001357326.1| 387093.SUN_0008 WP_011979702.1.96465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]