SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 387093.SUN_0442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  387093.SUN_0442
Domain Number 1 Region: 93-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000536
Family NfeD domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 387093.SUN_0442
Sequence length 153
Comment (Sulfurovum NBC37-1)
Sequence
MIEFLTQYITWWHWIILGILFIIIEMGTGTFITLGFGVAAIIVGLLDLVVSMNFLVQVTL
WLILSVAIIAFLFKYFKKQPTVSNTGQSDQGLDTLGTVTKRIEQHGRGKIRFDEPVLGNT
VWHASANQTLDVGERVKIEAVNGQLIKVVPVSE
Download sequence
Identical sequences A6Q7E3
387093.SUN_0442 WP_011980135.1.96465 gi|152992038|ref|YP_001357759.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]