SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 387093.SUN_0802 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  387093.SUN_0802
Domain Number - Region: 55-97,139-217
Classification Level Classification E-value
Superfamily Autotransporter 0.000602
Family Autotransporter 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 387093.SUN_0802
Sequence length 234
Comment (Sulfurovum NBC37-1)
Sequence
MKTITMNLKKSLLFAGGLLLAGQSLQAAGADDPIRTMLLMDKFEILDNDDNSREWEGSFY
VGYDLDKLYIYSQGAATSDGLERSQNDLVYSRAIAPFWDIQAGIAYDKNSDASKTWGEIA
IAGLAPYFFETRAALLLNGDGNVGLRLEGEYEALITQKLILTPSIEADFYTKDDPVMQIG
SGLSAMEAGLRLRYEFVREFAPYIGVTWEKTFGNTRDFNPVDETSLLAGIRFWF
Download sequence
Identical sequences A6Q8F1
387093.SUN_0802 gi|152992396|ref|YP_001358117.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]