SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 387093.SUN_1213 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  387093.SUN_1213
Domain Number 1 Region: 141-423
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.99e-113
Family Enolase 0.0000000701
Further Details:      
 
Domain Number 2 Region: 6-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.31e-51
Family Enolase N-terminal domain-like 0.00000914
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 387093.SUN_1213
Sequence length 425
Comment (Sulfurovum NBC37-1)
Sequence
MSKSSIVSIDAIEILDSRGNPTVRVLMELDDGTEASASVPSGASTGEYEAHELRDGDKKR
YGGKGVKKACENIVKQIAPTLLGMDASEQAKIDRTLIELDGTDDKSRLGANAILGVSMAA
AKAAAQSQHTPLYRYLGGAEARRLPVPCMNILNGGEHADNSVDFQEFMAVPHGAPSFSEG
LRYVAETFHTLKKLLHERGLATSVGDEGGFAPDLGSNEEAIELIVEAIEKSGYRPGEDIS
IAIDSAATSFSTDKKGHYDLKWSGAGKMQSNDLIALAKEWVDKYPIILWEDPLAEEDWEG
FAQFTSALGDKIEVVGDDIFVTNTKFISRGIREHTANASLIKLNQIGTVSETVAAVRLCE
ENGWRSFLSHRSGETADTFLADFAVAMQSGHLKSGSASRSERLAKYNRLLEIEHALGTDA
KYYWK
Download sequence
Identical sequences A6Q9K9
gi|152992804|ref|YP_001358525.1| WP_011980901.1.96465 387093.SUN_1213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]