SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 387344.LVIS_1998 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  387344.LVIS_1998
Domain Number 1 Region: 45-255
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-41
Family Mycobacterial PtpB-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 387344.LVIS_1998
Sequence length 260
Comment (Lactobacillus brevis ATCC 367)
Sequence
MRFQTVLTTLGCATIMATAVTPAYAATAKDSQLQPAISQKVNRPIHLEGGENMRDLGGYR
TKSGQRVKMGKVLRSASLENLTATDVLNLQVNHQLTEIVDLRTTEQIMKKPDPVMEGVKY
LQASVLGTRSNYDDDDQGMYDDMAHKAAAKRSYRSLLIQIAENKRGALLFHCSHGMDRTG
TAAAILYSILGVSKRDIQRDYLLSNTQLGVTWAKPALLNSFYKQINQQYGSMDKYVKHGL
KLSPAQIKAIKTNLLTKAPH
Download sequence
Identical sequences M5AH20 Q03P16
gi|116334560|ref|YP_796087.1| gi|472407717|ref|YP_007654822.1| WP_011668676.1.10245 WP_011668676.1.33510 WP_011668676.1.57633 WP_011668676.1.67033 WP_011668676.1.68109 WP_011668676.1.80197 387344.LVIS_1998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]