SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 388396.VFMJ11_1018 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  388396.VFMJ11_1018
Domain Number 1 Region: 115-211
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.24e-19
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 388396.VFMJ11_1018
Sequence length 217
Comment (Vibrio fischeri MJ11)
Sequence
MKKVSADDNFYFLFFALLGLLFMSAVMQQLFSGGQKTVLALIIICLAVSIVGVNRKQALY
RTWYGFLLSIASISGGLSFLEGYDLSLITLGALLFFLLSHTYTALKQVMLPDNVSRNQIV
GSICVYLLLGVSWAIIYLIQIELFPDSFNGIEPKPWMDNLFDAIYFSFITLTTVGYGDIS
PILPIPRFFVFIESILGGFYLAIMVASLVSSHLSQSR
Download sequence
Identical sequences A0A1B9PCN7 B5FD22
WP_005418654.1.100783 WP_005418654.1.102040 WP_005418654.1.23113 WP_005418654.1.34024 WP_005418654.1.3463 WP_005418654.1.34959 WP_005418654.1.44395 WP_005418654.1.62330 WP_005418654.1.66091 WP_005418654.1.77059 WP_005418654.1.82276 WP_005418654.1.94618 388396.VFMJ11_1018 gi|197334259|ref|YP_002155740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]