SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 388396.VFMJ11_A0040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  388396.VFMJ11_A0040
Domain Number 1 Region: 95-359
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.93e-74
Family D-glucarate dehydratase-like 0.0000537
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.21e-30
Family Enolase N-terminal domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 388396.VFMJ11_A0040
Sequence length 382
Comment (Vibrio fischeri MJ11)
Sequence
MKIVSYETFIVPPRWGFIKIVTDEGIIGWGEPSLEGRTHTVHTCVDEMMEYLIGKDPRDI
ELHWNYLHRSSFYRGGPVFMSALAGIDQALWDIKGKALGVPAYQLLGGKCRDKIRTYSWI
GGDRPDDVVRMAKEKQDEGFTAIKMNATEELNYIDDYSKIDALLTRVQSIRDAVGSDMGI
GIDFHGRVHKAMAKILMRELEPMHPMFVEEIVLPEHLDAIHEIAQYGAIPIATGERLHSR
WDFKTLLERGGIDIIQPDVCHCGGITEMKKIASMAETYDVALAPHCPLGPVALASSVHVD
SCSQNAIIQEQSIGIHYNKGNDVLDYIDNKDAFTFEEGYCLNLEGDGLGVEINEAFMREQ
GKINPRWRNPHWTNKDGSFAEW
Download sequence
Identical sequences B5ESA8
388396.VFMJ11_A0040 WP_012535030.1.44395 gi|197337160|ref|YP_002157597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]