SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 388396.VFMJ11_A0203 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  388396.VFMJ11_A0203
Domain Number 1 Region: 88-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000327
Family NfeD domain-like 0.0065
Further Details:      
 
Weak hits

Sequence:  388396.VFMJ11_A0203
Domain Number - Region: 27-89
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00118
Family LacY-like proton/sugar symporter 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 388396.VFMJ11_A0203
Sequence length 150
Comment (Vibrio fischeri MJ11)
Sequence
MEFFEQMNHWHWLTLGLLLLAGELLGTAGYFLWIGLSAVAVGALYAVIPLSWQMQWISFA
VFSLFTTWLWWRYQHKKDMSSDAKRALNQKDKQLIGQTSRLEEDVHAGSCRIVLGDTTWS
AKSAVDIEKGTLVRVVSVDGIILTIEPVKK
Download sequence
Identical sequences A0A1B9PHG4 B5ESU2
gi|197337790|ref|YP_002157760.1| WP_012535553.1.198 WP_012535553.1.21686 WP_012535553.1.31530 WP_012535553.1.32349 WP_012535553.1.34024 WP_012535553.1.3463 WP_012535553.1.44395 WP_012535553.1.85856 WP_012535553.1.93430 WP_012535553.1.97281 388396.VFMJ11_A0203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]